KEGG   Planococcus sp. PAMC 21323: Plano_2961Help
Entry
Plano_2961        CDS       T03510                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pln  Planococcus sp. PAMC 21323
Pathway
pln00051  Fructose and mannose metabolism
pln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Plano_2961
Enzymes [BR:pln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Plano_2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N ApbA Pyr_redox_2 Sacchrp_dh_NADP BioT2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIY06926
UniProt: A0A0B4RFX5
Position
complement(3035086..3036225)
Genome map
AA seq 379 aa AA seqDB search
MKQAVHFGAGNIGRGFIGALFSKSGYHVTFVDVAEQVINKLNEEKSYQVKLAQSQEEKIT
IENVSGINNMTHAEDVIRVIQQATYLTTAIGPNILPRIAPLIAQGLTERILATDEKLYII
ACENQIGATDILKQHILDSLDDETIAKLEGKVYFFNSAVDRIVPIQDQSSLDVLVEPYFE
WVVETTETIPPVTGMTLVEDLAPFIERKLFTVNTGHAVIAYLGYLAGKSTIDETLADEEI
VTQVRETLKETGAYLVKEYGLDEQEHLAYIDKNIERFKNAYLNDGVTRVGRAPIRKLGPE
DRLIRPATQAQKAGLSYTHLANAIAAALLFDYPEDEEALEIQKIIRDNGPAAVLTTISGL
PKDSDITKEVVSRYHALKA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagccgtccattttggagcaggtaatattggcagaggatttatcggggcttta
ttttctaaatcaggctatcacgtgacgtttgtcgacgtggcagagcaagtaattaataag
ctcaatgaagaaaaaagctatcaagtaaaactagcccaatcacaagaagaaaagattaca
attgaaaacgtttcggggattaataatatgacacatgccgaagatgtgattagagtgatt
caacaagcgacatatttaacaactgcgattgggccaaacatcttgccgagaatcgctcca
ttaattgcacaagggttaacagagcgtatattggcgacagacgaaaagttgtatatcatc
gcctgcgaaaatcagattggtgcgactgacatattaaagcagcacattctagacagttta
gatgacgagacaatagcgaaactagaagggaaagtatattttttcaactcagcagttgat
cgcattgtacccatacaagaccaaagttctttagatgtattagtagagccgtattttgaa
tgggtagtggaaactacagaaacgattccaccagtaacaggtatgacgctagttgaagat
ctcgctccttttattgaacgaaaattatttacagtaaatacgggtcatgccgtgattgcc
tatttggggtatttagccggcaaatcaacaatcgacgaaacattagccgatgaggaaatt
gttacacaggtcagagagacccttaaagaaacgggtgcgtatttagtaaaagaatatgga
cttgatgaacaagagcatttagcttatatcgataaaaacattgaacgctttaaaaatgca
tacttgaatgacggtgtgacacgagtagggcgtgcacctattcggaaactaggaccagaa
gatcgattgattcgtccggctacacaagctcaaaaagcaggcttgtcttatacgcactta
gcaaacgcgattgcggctgcattgttgtttgattatccagaagatgaagaagcgttggaa
attcaaaaaataattcgagacaacggacctgcggctgttttaacgaccattagtggttta
cctaaagacagtgacattacaaaagaagtcgtaagccgctaccatgcgttgaaagcttaa

DBGET integrated database retrieval system