KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: C548_111Help
Entry
C548_111          CDS       T02307                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plo  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
plo00020  Citrate cycle (TCA cycle)
plo00310  Lysine degradation
plo01100  Metabolic pathways
plo01110  Biosynthesis of secondary metabolites
plo01120  Microbial metabolism in diverse environments
plo01130  Biosynthesis of antibiotics
plo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C548_111
  Amino acid metabolism
   00310 Lysine degradation
    C548_111
Enzymes [BR:plo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C548_111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh DUF979
Motif
Other DBs
NCBI-ProteinID: AFT80477
Position
132009..133079
Genome map
AA seq 356 aa AA seqDB search
MLEVVSPTEGFLQIIKIPVGKKCKSEQLLGIIVAQKEEGFYSSGSSSTNIKQQKLCKKEQ
KVDESEKQELKQFYKQAIELEESYSPEVRKAKTSIDVENLFENGTVQDKRVNIRKENVKY
SINEIGVKRVQLSRLRQTITKRIVKAQKNAAMLTTYNEVDMGNILEIRTKYRELFEKKHG
TKLGLMGFFVKACTVALKQFKKVNAVIDDKEIVYHNYQDIGIAVSTNRGLVVPILRHTDS
IKIEEIEKKIMDFRKRGVDGKLSIKELTGGTFTISNGGVFGSLFSTPIINPPQTAILGMH
KIQNRPVVLKGEIVIRPMMYLALSYDHRLIDGKDAVNFLFFVKELLEQPIRFILNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaggttgtttcaccaactgaagggtttcttcaaattataaagataccagtaggt
aaaaaatgcaaatccgagcaattgttaggtattattgtagcacaaaaagaagaaggtttt
tatagttcaggttcatcaagcacaaacatcaaacagcaaaaattgtgtaaaaaagagcaa
aaggtagatgaatcagaaaaacaagaattaaaacagttttataaacaagcaatagaatta
gaagaaagttattcaccagaggtacgtaaggctaagactagtatagatgttgaaaactta
tttgagaatggcacagtacaagataaaagggtaaatattagaaaagaaaatgttaaatat
agtattaatgaaattggagttaaaagagtacaattaagtcgtttacgtcagacgattact
aaacgtatcgtgaaagctcaaaaaaatgctgcaatgttaactacttataatgaagtagat
atgggtaatatattagaaatacgcacaaaatatcgagaactatttgaaaagaaacatgga
actaagctagggttaatgggattttttgtaaaagcttgtacggtggcgctaaaacagttc
aaaaaagtaaatgcagttattgatgataaagaaattgtttatcataattatcaagacata
ggaatagcagtttctacaaataggggtttagttgttcctattttaaggcatactgattct
ataaaaatagaagaaatagaaaaaaaaattatggattttaggaaacgtggtgttgatgga
aaattaagtattaaagaattaactggtggaacttttacgataagtaatggaggagttttt
ggatctctgttttctactcctattattaatccccctcaaactgctattttgggaatgcat
aaaattcaaaaccgtcctgtagttttaaaaggagaaatagttatacggcctatgatgtat
ttagccttgtcgtatgatcatcgtcttattgatggaaaagatgcagttaattttttattt
tttgttaaggagcttttagaacaacccattcgttttatattaaacatttaa

DBGET integrated database retrieval system