KEGG   Polystyrenella longa: Pla110_14330
Entry
Pla110_14330      CDS       T06945                                 

Gene name
hcrA
Definition
(GenBank) 4-hydroxybenzoyl-CoA reductase subunit alpha
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
plon  Polystyrenella longa
Pathway
plon00230  Purine metabolism
plon01100  Metabolic pathways
plon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pla110_14330 (hcrA)
Enzymes [BR:plon01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Pla110_14330 (hcrA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QDU79719
UniProt: A0A518CKG6
Position
1831942..1834230
AA seq 762 aa
MATAEHKKTGVSSNSKYKVIGTRPIRPDGVDKVTGRAKYGADIRLSGMIHGAVLRSPHAH
ALVKSIDTSRAEQLEGVFAVTTHKDFPDATDKIADLGEGAINLKHLSSNVLADEKVLYKG
HAVAAVAAESIHIAEEALALIQVEYEVLPHVIDVRKAMQDDAPILLDNLRLEDMSPDSVP
SDKPSNIAKKFFFEEGDPEAAFAKAKVVVEREFTTSTVHQGYVEPHASTAVWSADGKVTL
YTCTQGTFSVRHQVAELLGMPVSYVKVIPTEIGGGFGGKITVYLDPIAVVLSRKSGRPVQ
MVMDRASVFEATGPTPGSWMRVKMGADENGKLIAAEAEIAFEAGAYPGSPIAAGCMCVFS
CYEIPDGRIIGYDVCVNKPRSAAYRAPGSTQVAYATETVVDEICEKLGMDPAEFRLNNAA
VEGTRRIDGVQYPRIGLVETIEAIQQTEHWKTPLEGPNRGRGIASGYWMNAGLKSAVTAT
VNGDGKVALVEGSTDIGGSRASIAMQFAETLGIAMEDVIPAVVDTDSVGYTDVTGGSRVT
YATGWAAYEAALDIRRQFCTRAAEFWEVDPSEVTYEDGGVKGPGDKWYGFVELAEQISKV
SEPVVGRGVSNHNEPGGAFGTHAVDVEVDPDTGKVTILKYTAAQDVGTAIHPAYVEGQVQ
GGVVQGIGWALNEEYFYDDAGVMRNASYLDYRVPTCYDLPMIDALLVEVPNPGHPYGVRG
VGEVPIAPPPAAIANAINQAIGIRMQHLPMSPPHVLHEILKK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggcgaccgcagaacacaaaaaaacgggtgtgtcctccaacagtaaatacaaagtgatc
ggtacgcggcccattcgaccggacggcgtcgacaaggtgaccggccgcgccaaatatgga
gccgatatccggctgagtggtatgattcatggagcggttctgcgaagcccgcacgcccat
gcactggtcaaatcgattgataccagccgcgcggaacaactggaaggtgttttcgcagtc
accactcataaagacttcccggatgcgaccgataaaattgcggacctgggcgaaggtgcc
atcaatctcaaacacttaagcagtaatgtactggctgatgaaaaggtgttgtataaaggg
catgctgtagcggcagtcgcagcagagtcgattcatatcgcagaagaagcactcgcgttg
atccaggtcgagtatgaagtacttccgcacgtgattgatgtccgtaaagcaatgcaggac
gatgctcctattctgctggacaatcttcgtctggaagacatgagccccgattcggttcct
tccgataaaccttctaacatcgccaagaaattcttcttcgaagagggcgatcccgaagcc
gcttttgccaaagcgaaagtggtcgtcgaacgcgaattcaccacttctactgttcaccag
ggatacgtcgaaccgcatgcttcgaccgctgtctggtcagcagatggcaaagtgaccctc
tacacctgtactcagggaaccttctctgttcggcatcaagtggctgaattactgggaatg
cctgtttcctacgtgaaagtcataccaaccgaaatcggtggtggctttggtggaaaaatt
acggtttatctcgacccgatcgctgtcgtgctgtctcgcaaatcgggacgaccagtgcaa
atggtgatggaccgtgcttctgtctttgaagcaaccggtcccactccgggctcctggatg
cgagtcaaaatgggtgcggatgaaaatggtaaactgatcgctgcggaagccgaaatcgct
ttcgaagcgggagcctaccccggttcccccatcgccgcaggttgtatgtgcgtcttttcc
tgctacgaaattccggacggacgcatcatcggatacgacgtttgtgtgaacaaacctcgt
tcagccgcctaccgtgccccgggttctacccaggttgcatacgcgacagaaactgttgtc
gacgaaatctgcgaaaaactaggaatggacccggcggaatttcgtttgaataacgccgcc
gtcgagggaacacgccgtatcgatggtgtgcaatatccgcgaatcggtctggtggagaca
atcgaagcaattcagcaaacggaacattggaaaacaccactggaaggcccaaatcgaggc
cgaggtattgcttccggttattggatgaatgccggtttgaaatcagcagtgacggcgacc
gtcaacggtgatggaaaagtcgctctggtggaaggttcgactgatattggcggaagccgg
gcatctattgccatgcagttcgccgagacattgggcatcgcgatggaagatgtcattccc
gccgtcgtcgataccgacagcgtcggttacaccgatgtcaccgggggaagccgagtcact
tacgcgactggctgggccgcttatgaagcggcgctggatattcgtcgtcaattctgtacg
cgcgccgccgagttctgggaagtcgatccttccgaggtcacttatgaggatggtggcgta
aaaggtcctggagataaatggtacggctttgttgaactagccgaacagatttcgaaagtc
agtgaaccggtcgttggtcgcggagtgtccaatcacaacgaacctggtggtgccttcggg
actcacgcggtcgacgtcgaagtcgatccggacaccggaaaggtgacaatcctcaaatac
actgccgcacaggatgtcggaacagctattcaccccgcttatgtcgaaggacaagtgcag
ggtggtgttgtccagggaatcggttgggctctcaacgaagaatatttctacgatgatgct
ggtgtcatgcgaaatgccagctacctagattaccgggttccgacttgctacgacttgccc
atgattgatgctttgttggtagaagtgcccaaccccggacatccgtacggtgtgcgaggc
gttggtgaagtccccatcgctccaccacccgctgcaattgccaatgcgataaatcaggct
attggtattcgcatgcaacatctacccatgtcgcctccacacgtgcttcatgagatcctg
aagaaataa

DBGET integrated database retrieval system