KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2086Help
Entry
Ple7327_2086      CDS       T02367                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ple7327_2086
Enzymes [BR:plp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ple7327_2086
Transporters [BR:plp02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ple7327_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY77414
UniProt: K9T5X4
Position
2244475..2245035
Genome map
AA seq 186 aa AA seqDB search
MLKLYGGVRSRASIVQWYLEELGIPYEFVLLDMEAGEHRKPDFLAINPIGKVPAIVEGDF
RLWESGAILLYLAEKYGKMPESLEGKSTIAQWVIFANSTLATGLFVESVREQETPKLLTP
LNQIFDRQPFLLGDEFTVADVAVGSILAYVPMMLKLDLSEYPAVLGYIQRISERPAFGKT
IGKRSA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaactttacggcggcgttcgttctagagcttccatcgtccagtggtatttggaa
gaattaggaattccttacgaattcgtcctgctcgatatggaagccggagaacaccgaaaa
ccagattttctggcaattaatcccataggaaaagttcctgcgattgttgagggagatttt
cggctttgggaatcgggagcgattttgctttatttagcagaaaaatacggcaaaatgccc
gaatctttggaggggaaaagcacgatcgctcaatgggtaatttttgccaattcaaccttg
gcgacgggactttttgtcgaaagcgttcgggagcaggaaacgccgaagttattgacaccg
ctcaatcagatcttcgatcgccagccatttctattaggcgacgagttcactgtggctgac
gttgccgtcggctcgattttggcttacgtgccgatgatgctaaagctagatttgagtgaa
tatccagccgttttaggctatatccagagaatttccgaacgacctgcctttgggaaaaca
ataggtaagcgttctgcctaa

DBGET integrated database retrieval system