KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3277Help
Entry
Ple7327_3277      CDS       T02367                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00260  Glycine, serine and threonine metabolism
plp00750  Vitamin B6 metabolism
plp01100  Metabolic pathways
plp01110  Biosynthesis of secondary metabolites
plp01120  Microbial metabolism in diverse environments
plp01230  Biosynthesis of amino acids
Module
plp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ple7327_3277
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ple7327_3277
Enzymes [BR:plp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ple7327_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Ad_Cy_reg
Motif
Other DBs
NCBI-ProteinID: AFY78498
UniProt: K9T7V0
Position
3528974..3530281
Genome map
AA seq 435 aa AA seqDB search
MTQATQTQTPSTFTPTFTKLVSKEGGTEYPLKALHICEETFAPLEVAYDYDLIRRQVSRE
SIQAGPNSIWRYRAFLPVATENPIDVGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPTL
SFKDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLG
TLIYNPTVMAVKGNYDQVNRLCSEVGNTYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWK
LPDHIVAPLASGSLYTKIYKGFQEFVKVGLVEDKNVRFSGAQAEGCSPIAQAFREERDFV
TPVKPNTIAKSIAIGNPADGIYALEIARKTGGNIESVTDAEIVEGIKLLAETEGIFTETA
GGTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQGYIGEPLVIEPKLDSFERALE
RSRTLERLEWQQVLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggcaacccaaactcaaaccccatctacttttactcccaccttcaccaagcta
gtttctaaagaaggaggaaccgaatacccgcttaaagctctccatatttgtgaggaaacc
tttgcgcctctagaagtggcttacgactacgacctcattcgccgccaagttagtcgcgaa
agcatccaagcgggaccaaactcaatttggcgctatcgggcatttctccccgtcgctact
gaaaatcctattgacgtgggaactgggatgactcccctagtcaaatctcatcgcttggcg
cgtcgcctgggtttgaagaatctctacatcaaaaatgatgccgtcaatatgcctaccctc
agcttcaaggatagggtagtatccgttgcgctgactcgcgcccgcgaactaggatttaca
acggtttcctgtgccagtacgggtaacttagctaattctactgccgcgatcgcagctcat
gcaggattagattgctgcgttttcatccctgcggatctcgaagctggaaaagtcctaggc
actttaatttacaatcctactgtcatggcggttaaaggcaattacgaccaagtaaaccgc
ctgtgttcggaagtgggtaatacctatggatggggatttgtcaacatcaacttgcgtccc
tactattctgaaggctcaaagacattaggatttgaagttgccgaacagttgggatggaaa
cttccggatcatatcgttgcgcctctcgcatctggttctttatacaccaagatttacaag
ggcttccaagagttcgttaaagttggcttagtagaagataaaaacgttcgctttagcggc
gcacaagcagaaggatgttctcccatcgcgcaagctttcagggaagaaagagactttgtt
acgcctgtcaaacccaatacaattgccaagtctattgccattggcaacccggctgacggg
atttatgcactagaaattgcgaggaagacaggtggtaatattgaatcggttactgatgcc
gaaattgtcgaaggaatcaagttactagccgaaaccgaaggaatcttcaccgaaaccgca
ggcggtacgactgttgcagtattaaagaaattggtagaagccggaaaaatcgaccccgat
gaaactacagtagtttatattacgggtaacggactcaagactcaggaagccgtgcagggt
tacattggcgaacctctagtcattgagccaaaattagatagtttcgagcgtgctttagaa
cgttctcggacgctagaacgccttgaatggcaacaagttttggtttag

DBGET integrated database retrieval system