KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3802Help
Entry
Ple7327_3802      CDS       T02367                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00860  Porphyrin and chlorophyll metabolism
plp01100  Metabolic pathways
plp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ple7327_3802
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Ple7327_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AFY78969
UniProt: K9TAD3
Position
complement(4046704..4048101)
Genome map
AA seq 465 aa AA seqDB search
MKLLSQVVEFEPNLLRKYDRPLPRYTSYPPATELKEAFEEIDFRAAIAVGNRKKTPLSLY
CHIPFCETACYFCGCNTVITQRKQIAELYLNYISRHIQQMATLVDRDRQVCQLHWGGGTP
NYLSLKQIEALWTTLNQYFQFAPNAEVSIEVNPRFLDKDYILFLRNLGFNRISFGIQDFN
PRVQQAVNRIQPEAMLFGAMDWIRSAGFESVNVDLIYGLPYQTLETFKDTVRKTIDLDPD
RIAVFNFAYVPWMKPIQRRIPQEALPQSAEKLNILKMTIEELTGNGYVFIGMDHFAKPND
ELAIAQRNGQLHRNFQGYTTQPESDLLGFGMTSISMLQDVYVQNHKRLKRYDRAIDAQEL
PIERGVTLSRDDIIRRTAIMELMCQFQLSPDDIEDKYHLGFDLDWKEYFLKERYNLRLLE
ADGLLELRGDLIRVTPAGRLLIRNIASVFDIYLRTQQSDRFSQAV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctatcccaagtcgtcgaattcgagccaaatttactgagaaaatacgatcgc
cccttgccgcgatatactagctacccacccgcaacggaactgaaagaagcctttgaagaa
attgattttagagcggcgatcgctgtggggaatcgcaaaaagacacctctatcgctttac
tgtcatattcccttttgcgagaccgcctgctatttctgtggttgcaatacggttattacc
caacgcaagcagatagcggagctttatctcaattacatcagtcgccatattcaacaaatg
gccactctcgtggatcgcgatcgccaagtttgccaacttcattggggtggcggtacgccc
aattacctttccttgaaacagattgaagccctttggacgacattgaatcaatattttcaa
ttcgctcccaacgccgaagtttccatcgaggttaatcctcgttttttagacaaagactat
atcctctttttaagaaacttaggatttaaccgcattagtttcgggattcaagactttaat
cccagagtgcaacaagccgtcaaccgcattcaaccagaagcaatgttgtttggggcaatg
gattggattcgttcagcaggatttgagagtgtcaacgtcgatttaatctatgggttaccc
tatcaaaccttagagacatttaaggacacggttcgtaagacgattgacctcgatcccgat
cgcattgccgtctttaattttgcttacgtgccttggatgaaacccattcaacggcgcatt
cctcaagaagctttgccacagtctgccgaaaagctgaatattctcaaaatgaccattgag
gaattgactgggaatggttacgtattcattggcatggatcattttgccaaacccaatgac
gaactagcgatcgcccagcgaaacgggcaattgcatcgcaactttcaaggatacaccacc
cagccagaatccgatttacttggttttggcatgacttccattagtatgttgcaagatgtt
tacgtgcaaaaccataaacggttaaagcgatacgatcgagcgatcgacgcacaagaatta
ccaatcgaaaggggagtcactctcagtcgagacgacatcattcgtcgaaccgcgattatg
gagttaatgtgtcaatttcagctttcaccagatgatattgaagacaaatatcatctcggc
tttgacctcgactggaaagagtatttcttgaaagaacggtataatttacgcttgctagag
gcagacgggttgctcgaactcagaggcgatctcattcgagtgactccggcgggacggttg
ctgattagaaacattgcatccgtgttcgatatctatcttaggactcagcaaagcgatcgg
ttttcccaagccgtataa

DBGET integrated database retrieval system