KEGG   Pleurocapsa sp. PCC 7327: Ple7327_3865Help
Entry
Ple7327_3865      CDS       T02367                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00430  Taurine and hypotaurine metabolism
plp00620  Pyruvate metabolism
plp00640  Propanoate metabolism
plp00680  Methane metabolism
plp01100  Metabolic pathways
plp01120  Microbial metabolism in diverse environments
plp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ple7327_3865
   00640 Propanoate metabolism
    Ple7327_3865
  09102 Energy metabolism
   00680 Methane metabolism
    Ple7327_3865
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Ple7327_3865
Enzymes [BR:plp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Ple7327_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFY79023
UniProt: K9T9C3
Position
complement(4110396..4111613)
Genome map
AA seq 405 aa AA seqDB search
MKVLILNAGSSTHKSSLYEIAGETLSERASEPLWKAGIDWTATADRGVLSVKAKRSTIEI
ELESSDRPQGIARMLETLVRGETKVIEQFSEIDVVGHRVVHGGIDYTQATQVTPAVKAAI
ARLIPLAPAHNPAHLEGIDAIAQVLGDIPQVAVFDTAFHSQMPPQAAVYPIPYEWFERGI
RRYGFHGISHQYCARRAAQLLGKPLESLKLITCHLGNGCSLAAIKNGISIDTTMGFTPLE
GLMMGSRSGSIDPAILIYLMREYNFDADRVNEMLNQESGLKGVSGVSSDWRAIEAAIAQG
NQRAQLAVDIYIHRLRACIGSMLASLGGLDAIVFTAGVGENAASVREKACQAFEFLGLKL
DKEKNDNRPVDENIATRDSTVRVLVIHTEEDWAIAQQCWGIMNDE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttaatcttgaatgcgggttctagcactcacaaaagtagcctgtacgaaatc
gcaggagaaactttgtcagagcgagcaagcgaacccttatggaaagcaggtatcgattgg
acggcaacggcagatagaggcgttttaagcgtaaaagctaagagatcgacaatagagatc
gagttagaatcaagcgatcgcccccaaggaatcgcacgaatgctagaaacgctggtgcgg
ggagaaactaaagtcatagaacagttttcagaaatcgatgtcgtcggtcatcgcgtcgta
cacggcggaatcgactatactcaagccacccaagtcacgccagccgtcaaagcggcgatc
gcccgcctcattcctttagcacccgcacacaaccccgcgcatttagaaggaattgacgcg
atcgcgcaggtattgggcgatattcctcaagtcgccgttttcgatactgcatttcacagc
caaatgccacctcaagcagccgtttatcccattccctatgagtggtttgagaggggcatc
cgtcgctatggctttcacggcattagccatcaatattgtgcccgacgagcagcccaactc
ctcggcaaaccgctagaatcgctaaaactcatcacctgtcatttggggaatggctgttcc
cttgctgccattaaaaacggcatcagcatcgataccacgatgggatttacgcctctagaa
ggattgatgatgggaagtcgcagcggttccatcgatccggcaattctcatttatttgatg
cgggaatacaattttgatgccgatcgcgttaatgaaatgctcaaccaggagtcgggttta
aagggcgtatcgggagtttcgtccgattggcgggcaatagaagccgcgatcgcccaagga
aatcaacgcgcccaacttgctgttgatatttatattcatagactgagagcctgtatcgga
tcgatgcttgcctctcttggcggtttagatgccatagtgtttaccgcaggcgtgggagaa
aatgcagccagcgtgagagaaaaagcctgtcaagccttcgaatttttaggattaaagtta
gataaagaaaagaacgacaatcgcccggtagatgagaatatagcaacacgagattcgact
gtgagggtgttagtcattcatactgaagaagattgggcgatcgcccaacaatgttgggga
attatgaatgatgaatga

DBGET integrated database retrieval system