KEGG   Pseudomonas lundensis: AA042_07430Help
Entry
AA042_07430       CDS       T05473                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
plq  Pseudomonas lundensis
Pathway
plq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:plq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AA042_07430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:plq03011]
    AA042_07430
Ribosome [BR:plq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AA042_07430
  Bacteria
    AA042_07430
  Archaea
    AA042_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOZ12506
UniProt: A0A266NFL9
Position
complement(1662212..1662544)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSNKKAAEIIKKVLESAVANAEH
NEGADVDDLKVATVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcaac
aagaaagccgccgagatcatcaagaaagtgctggagtcggccgtagccaacgccgagcat
aacgaaggcgcagacgttgacgacttgaaagtcgccaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccgcgtgccaaaggccgcgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system