KEGG   Pseudomonas lundensis: AA042_12685Help
Entry
AA042_12685       CDS       T05473                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
plq  Pseudomonas lundensis
Pathway
plq00230  Purine metabolism
plq00250  Alanine, aspartate and glutamate metabolism
plq01100  Metabolic pathways
Module
plq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AA042_12685
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA042_12685
Enzymes [BR:plq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AA042_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AOZ13411
UniProt: A0A1D9IMU1
Position
2811309..2812598
Genome map
AA seq 429 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKIVDLLTEHAAAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGV
LREGVQCLIGNGVVVAPDALLREIIKLEEKGVPVRERLRISPSCPLILSFHVALDQAREK
ARGELKIGTTGRGIGPAYEDKVARRGLRVGDLLNMPRFEAKLRELVEYHNFMLVGFYKEP
AIDFDKTLAECKEYAELLKPLMLDVTAELHDLRRAGKDIMFEGAQGSLLDIDHGTYPYVT
SSNTTAGGVATGSGVGPMFLDYILGITKAYTTRVGSGPFPTELFDDVGAHLAKQGHEFGA
TTGRARRCGWFDAVILRRAIDVNSISGICLTKLDVLDGLETINICIGYKDADGNEIAPTD
ADSYVGLQPVYEEVPGWTESTVGAKTLEELPANARAYIKRVEALIGAPIDIISTGPDRNE
TIVLRHPFA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaatgtcgtagtcctgggcacccaatggggtgatgagggcaaaggcaagatc
gttgatctgctgaccgaacatgctgccgctgtagtgcgttaccagggcggccacaacgcg
ggccacacgctggttatcgacggcgaaaaaaccgtattgcacctgattccgtcgggcgtg
ttgcgcgaaggcgtgcaatgcctgatcggcaacggcgtcgtggttgctcccgatgccctg
ctgcgtgaaatcatcaagctggaagagaaaggcgtaccggtgcgtgagcgcctgcgtatc
agcccgtcctgcccgctgatcctgtccttccacgtggcgctggaccaggcccgtgaaaag
gcccgtggcgagctgaagatcggtacaaccggtcgcggcatcggcccggcttacgaagac
aaggtcgcacgtcgtggcctgcgtgtcggcgacctgctgaacatgccgcgctttgaagcc
aagctgcgtgagttggtggaataccacaacttcatgctggtgggtttctacaaagaaccg
gccatcgacttcgacaagaccctggccgagtgcaaggaatacgccgagctgctcaagccg
ctgatgctggacgtgacagccgagctgcacgacctgcgtcgcgctggcaaagacatcatg
ttcgaaggcgcgcaaggttcgttgctcgacatcgaccacggcacctacccgtacgtgacc
agctccaacaccacggccggtggcgttgcgaccggttcgggcgtaggcccgatgttcctg
gactacatcctgggcatcaccaaggcgtacaccacccgcgtgggttcgggcccgttcccg
actgagctgttcgacgacgtcggcgctcacctggccaagcaaggtcacgagttcggcgcc
accactggccgtgcccgtcgttgcggctggttcgacgccgttatcctgcgccgcgctatc
gacgtgaacagcatctcgggcatctgcctgaccaagctggacgtactggacggtctggaa
accatcaacatctgcataggctacaaagacgcagacggtaacgagatcgcaccgaccgac
gctgacagctacgtgggcctgcagcctgtgtacgaagaagtgccgggctggactgaatcg
accgtgggcgccaaaaccctggaagaactgccagccaacgcacgtgcttacatcaagcgc
gtagaagcactgatcggcgcgccgatcgacatcatttcgactggcccggaccgcaacgaa
accatcgttctgcgtcacccgttcgcttaa

DBGET integrated database retrieval system