KEGG   Pseudomonas lundensis: AA042_14975Help
Entry
AA042_14975       CDS       T05473                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
plq  Pseudomonas lundensis
Pathway
plq00350  Tyrosine metabolism
plq00643  Styrene degradation
plq01100  Metabolic pathways
plq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AA042_14975
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    AA042_14975
Enzymes [BR:plq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AA042_14975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: AOZ13804
UniProt: A0A1D9IP11
Position
3315099..3315737
Genome map
AA seq 212 aa AA seqDB search
MELFTYYRSTSSYRVRIALALKGLDYQSVAVNLIAAGGGEHRQPHYLKLNPQGRVPALRT
EDGDVLTQSPAIIEYLEERYPQPPLLSDNLITRAHERGVASVIGCDIHPLHNVSVLNQLR
ALGQGEAHVTQWIGHWISSGLATIEQLIGDSGFCFGPQPGLADVYLIPQLYAAERFSVSL
AGYPRIARVAQLAAQHPAFINAHPSRQPDTPA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaactctttacttactatcgctcaacgtcctcgtatcgggtgcgtatcgcgctggcg
ctcaaggggctggattatcagtcggtcgcggtcaacctgatcgcggccgggggcggtgaa
catcgccagccacactacctgaagctcaacccgcaaggccgtgtgccggctttgcgcact
gaagacggcgatgtgctgacccagtccccggccatcatcgaatacctcgaagagcgttat
ccgcagccgccgctgctttctgacaacctgatcacccgcgcacatgagcgcggcgtggcg
agtgtgatcgggtgcgatattcacccgttgcacaacgtcagtgtgctcaatcaactgcgt
gccctggggcagggcgaagcccatgtcacgcagtggatcggccactggatttcttcaggc
ttggccaccatcgagcagttgattggcgacagcggtttttgttttggcccgcagccgggc
ctggcagatgtgtacctgattcctcagttgtatgcggccgagcgttttagcgtgtcgctg
gcaggttatccacgcatcgcgcgcgtggcgcaactggccgcgcaacatccggcgttcatc
aacgcacacccgtcacggcagcccgataccccggcttga

DBGET integrated database retrieval system