KEGG   Planctomyces sp. SH-PL14: VT03_08360Help
Entry
VT03_08360        CDS       T04354                                 

Gene name
ycdF
Definition
(GenBank) Glucose 1-dehydrogenase 2
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
pls00030  Pentose phosphate pathway
pls01100  Metabolic pathways
pls01120  Microbial metabolism in diverse environments
pls01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VT03_08360 (ycdF)
Enzymes [BR:pls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     VT03_08360 (ycdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AMV17892
UniProt: A0A142WTW0
Position
2125251..2126033
Genome map
AA seq 260 aa AA seqDB search
MKLSGRNILITGASRGIGRGCAIALAEQGANIGINYRSQAAEAEETAAIVRKHGGKAELY
QVDVSDQPAVEKMVESFAKDFGSVDGFISNAVYSDREVMIKADMAGFRKTIDVSMWGAFY
GVRAAAQKMVAQGKGGSIIVVSSPHGKIPVPTAMAYNMAKAAIDHMARTAAIELAQYRIR
VNIIHPGWIDTPGERKFFSDQQLAEGAANIPWKRMGTAEEMGRLATFMMSDDCDYMTGST
VLMDGGISLPWWSKREEGKQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctccggacgcaacatcctcatcaccggcgcctcccgcggcatcggccgcggc
tgcgccatcgccctcgcggaacaaggggccaacatcgggatcaactaccgctcccaggcc
gccgaagctgaagagaccgccgccatcgtccgcaagcacggcggcaaggccgagctctac
caggtcgacgtctccgaccagcccgccgtcgaaaagatggtcgagtccttcgccaaagac
ttcggcagcgtcgacggcttcatctcgaacgccgtctacagcgaccgcgaagtcatgatc
aaggccgacatggccggcttccgcaagacgatcgacgtctccatgtggggcgccttctac
ggagtgcgggccgccgcgcagaagatggtcgcccaggggaaggggggctcgatcatcgtc
gtcagctcgccgcacggaaagatccccgtcccgaccgccatggcctacaacatggccaag
gcggccatcgaccacatggcccgcacggccgcgatcgaactcgcccagtaccgcatccgc
gtcaacatcatccatccgggctggatcgacactcccggcgaacggaagttcttctccgac
cagcagctcgccgaaggggccgccaacatcccctggaagcggatggggacggcggaagaa
atggggcggctggcgaccttcatgatgtcggacgactgcgactacatgaccggcagcacg
gtcctcatggacggcggcatcagcctcccgtggtggtccaagcgggaagaaggaaagcag
tag

DBGET integrated database retrieval system