KEGG   Planctomyces sp. SH-PL14: VT03_26765Help
Entry
VT03_26765        CDS       T04354                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
pls00520  Amino sugar and nucleotide sugar metabolism
pls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VT03_26765
Enzymes [BR:pls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     VT03_26765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 adh_short KR DUF1815 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AMV21534
UniProt: A0A142X452
Position
complement(6893346..6894281)
Genome map
AA seq 311 aa AA seqDB search
MAQILVTGGAGFLGSHLCERLLERGDHVICVDNYFSGRKENIDHLRDHKRFELIRHDIVH
PLYVEAEQIYNLACPASPVAYQYNPIKTIKTSTVGMINVLGLARRCRARILHTSTSEVYG
DPEVHPQKEDYWGHVNPLGPRSCYDEGKRVAESLCMNYHLAHGIPIRIVRIFNTYGPRMD
PNDGRVVSNFIMQALRGESLTVYGHGKQTRSFCYVDDLVEGLIRMMDQNVDLGPINIGNP
VENTMLELAEAVLELTGSKSAVKHDPLPKDDPQQRRPDITKAKAILKWEPKVPLKEGLAK
TIEYYRRTQFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcacagattctggtgacgggcggagcgggcttcctgggaagccacttgtgtgaacgt
cttctcgagcgcggcgaccacgtcatctgcgtcgacaactacttctcgggccggaaggag
aacatcgaccacctccgcgaccacaagcggttcgagctgatccgccacgacatcgtccat
ccgctctacgtcgaagcggagcagatctacaacctggcctgccccgcctcgccggtcgcc
tatcagtacaacccgatcaagacgatcaagacttcgacggtcgggatgatcaacgttctc
ggtctcgcccgccgctgccgggcccggatcctccacacctcgacctccgaagtgtatggc
gatcccgaggtccatccgcagaaggaagactactggggccatgtgaacccgctcggaccg
cggagctgctacgacgaagggaagcgggtcgccgagtccctgtgcatgaactaccacctg
gcccacgggatcccgatccgcatcgtccggatcttcaacacctacgggccgcggatggat
cccaacgacggccgcgtcgtgtcgaacttcatcatgcaggccctccgcggcgagtcgctg
acggtctacggccacggcaagcagacccgctccttctgctacgtggacgacctcgtcgaa
ggcctgatccggatgatggaccagaacgtcgacctcggcccgatcaacatcggcaacccg
gtcgagaacacgatgctggagctggccgaggcggtcctcgagctgaccggctcgaagtcg
gcggtcaagcacgacccgctcccgaaggacgacccgcagcagcggcggccggacattacc
aaggccaaggcgatcctgaagtgggaacccaaggttccgctcaaggagggcctcgcgaag
acgatcgagtactaccgccggacgcagttcggctga

DBGET integrated database retrieval system