KEGG   Planctomyces sp. SH-PL14: VT03_30195Help
Entry
VT03_30195        CDS       T04354                                 

Gene name
ackA_2
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
pls00430  Taurine and hypotaurine metabolism
pls00620  Pyruvate metabolism
pls00640  Propanoate metabolism
pls00680  Methane metabolism
pls01100  Metabolic pathways
pls01120  Microbial metabolism in diverse environments
pls01200  Carbon metabolism
Module
pls_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VT03_30195 (ackA_2)
   00640 Propanoate metabolism
    VT03_30195 (ackA_2)
  09102 Energy metabolism
   00680 Methane metabolism
    VT03_30195 (ackA_2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    VT03_30195 (ackA_2)
Enzymes [BR:pls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     VT03_30195 (ackA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AMV22214
UniProt: A0A142X622
Position
complement(7738434..7739624)
Genome map
AA seq 396 aa AA seqDB search
MKVLVANLGSTSFKYRLFDMSNEAQLARGGIERIGQDAEGSCFVEIAGRRQEMSRRIKDH
AEAVAICLEQLTDPATGCLKSVDEVAAIGFKAVFAGKLSGVRIVNDELLDAMEALADVAP
AHNPPYARAMRQLRKAFPAMPLVAALETGFHETIPAEYRTYAIPHEWQEQYGIQRWGFHG
ASHRFIGGRVAQLLGRKGLKVISCHLGGSNSLCAMLDGVSQSNTLGMTPQTGLPHNNRVG
DFDPFAIPVLMRATGKTFPQILEDLSNKGGLLGMSGVSADARDVEKAAAEGNPRADLALN
VFAASIRQYIGAYLTVLNGADAIVFTGGIGENSQRIRRDSLKNLDFAGIQLDPELNKTAR
GEGRISAAGSRTEIWIVPTNEEIVVARQSVEAVKGK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctggtcgccaacctcggctccacctcgttcaagtaccggctgttcgatatg
tcgaacgaagcccagcttgcgcgcggcgggattgagcggatcggccaggatgccgaaggg
tcctgcttcgtcgagatcgccggccgccgccaggaaatgtcccgacggatcaaggaccac
gccgaagcggtcgcgatctgcctcgagcagttgaccgatcccgccaccgggtgcctcaag
tcggtcgacgaagtggccgccatcggcttcaaggcggtcttcgccggcaagttgagtggc
gtccggatcgtcaacgacgagctgctggacgcgatggaggccctggccgatgtcgctccc
gcccacaacccgccctacgcgcgagcgatgcggcagttgcggaaggcgttcccggcgatg
cccctggtcgccgccctcgaaaccggcttccacgagacgatccccgccgagtaccggacc
tacgccattccccacgaatggcaggagcagtacgggattcagcggtgggggttccacggg
gcgagccaccggttcattggcgggcgagtcgcccagctcctcggtcggaagggcctcaag
gtcatttcctgccatctcggaggcagcaactcgctgtgcgcgatgctcgacggcgtttcg
cagtcgaacacgctcggcatgactccgcagacgggactgccgcacaacaaccgggtcggg
gatttcgatccctttgcgatcccggtcctgatgcgggccacgggcaagacctttccgcag
atcctggaagacctctcgaacaagggggggctgctggggatgagcggagtgtccgccgac
gcgcgggacgtggagaaggccgccgcagaggggaatccccgggctgacctggcgctgaat
gtctttgccgcctccatccggcagtacatcggggcgtatctcacggtcctcaacggggcc
gatgcgatcgtcttcaccggggggatcggggagaacagccagcggatccggcgggactcg
ctcaagaatctcgacttcgcgggaattcagctcgatcccgagctgaacaagaccgccagg
ggagaaggccggatttcggccgccggcagcaggacggagatctggatcgttccgacgaac
gaagagatcgtcgtggcccgtcagtccgtcgaagctgtgaaggggaaatag

DBGET integrated database retrieval system