KEGG   Planctomyces sp. SH-PL14: VT03_30345Help
Entry
VT03_30345        CDS       T04354                                 

Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
pls00051  Fructose and mannose metabolism
pls01100  Metabolic pathways
pls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VT03_30345
Enzymes [BR:pls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     VT03_30345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AMV22244
UniProt: A0A142X651
Position
7779349..7780650
Genome map
AA seq 433 aa AA seqDB search
MPTTITRVSVHDLRFPTSKTLDGSDAMNPDPDYSAAYVILHTDRPDGLAGHGMTFTIGRG
NELCCQAIESLAALVVGRTLESFTDNLGAFWRHVTGDSQLRWVGPEKGVIHLATAAVVNA
VWDLYAKVEGKPLWRLLTDMTPEEIVRAIDFRYITDALRPEEAVAILQEKRATKSQRIEE
LERDGFPAYTTSAGWLGYDDEKLRALCRKCLADGWSCFKIKVGRDLEDDVRRCRIIREEI
GWDRRLMMDANQVWDVEQAVAWMEKLAEFKPWFIEEPTSPDDVLGHAAIADAVAPILVAT
GEHCANRVMFKQFLQAGAIGVCQIDSCRIGGVNEILAVMLMAAKFGVPVCPHAGGVGLCE
YVQHLSMFDYVAISGSMEDRLTEYAAHLHEHFLAPVVLRDGRYMPPTAPGYSIEMKPESI
ADYTFPTGARWRG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctactacgatcacccgcgtctccgtccatgacctccgctttccgacgtcgaagacc
ctcgacggctcggacgcgatgaacccggatccggactactcggcggcgtacgtcatcctc
cacacggatcggcccgacgggctggcgggccacgggatgacgttcacgatcggccgcggc
aatgagctgtgctgccaggcgatcgaatcgctcgcggcgctcgtcgtcgggcggacgctg
gaatcgttcaccgacaacctgggggccttctggcggcacgtcaccggcgacagccagctt
cgctgggtcgggccggagaaaggggtgatccacctcgcgacggcggcggtcgtcaacgcg
gtgtgggacctctacgccaaggtcgaggggaagccgttgtggcgtctcctgacggacatg
acgccggaggagatcgtccgggcgatcgacttccgctacatcaccgatgccctccggccg
gaggaggcggtggcgattcttcaggagaagcgggctacgaagagccagcggatcgaggaa
ctggagcgcgacgggttcccggcctacacgacgtccgcgggctggctcggctatgacgac
gagaagctgcgggcgctttgtcgaaaatgtcttgccgacggctggtcctgcttcaagatc
aaagtgggccgcgacctggaggacgacgtccgtcgctgccggatcatccgcgaggagatc
ggctgggaccgccgcctgatgatggacgccaaccaggtgtgggacgtcgagcaggcggtc
gcctggatggagaaactggccgagttcaagccgtggttcatcgaggagccgacgagcccg
gacgacgtcctgggacacgccgcgattgccgacgccgtggcgccgatcctcgtcgccacg
ggggagcactgcgcgaaccgggtcatgttcaagcagttcctccaggcgggggcgatcggc
gtctgccaaatcgactcgtgccggatcggcggcgtcaacgagatcctggcggtgatgctg
atggcggccaagttcggcgtgccggtctgcccgcatgccggcggcgtcgggctgtgcgag
tacgtccagcatctttcgatgttcgactacgtcgcgatcagtggttcgatggaggaccgg
ctgacggagtacgccgcccatctccacgagcatttcctcgcacccgtcgtcctgcgggac
ggccggtacatgccgccgacggcgccgggctacagcatcgagatgaagccggagtcgatc
gccgactacacgttcccgaccggggcgcggtggcggggctga

DBGET integrated database retrieval system