KEGG   Chlorobium luteolum: Plut_0501Help
Entry
Plut_0501         CDS       T00291                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plt  Chlorobium luteolum
Pathway
plt00010  Glycolysis / Gluconeogenesis
plt00260  Glycine, serine and threonine metabolism
plt00680  Methane metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
plt01130  Biosynthesis of antibiotics
plt01200  Carbon metabolism
plt01230  Biosynthesis of amino acids
Module
plt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_0501
  Energy metabolism
   00680 Methane metabolism
    Plut_0501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_0501
Enzymes [BR:plt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Plut_0501
Membrane trafficking [BR:plt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Plut_0501
Exosome [BR:plt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Plut_0501
  Exosomal proteins of melanoma cells
   Plut_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABB23389
UniProt: Q3B5J2
Position
586404..587147
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNLENRFTGWHDIDLTERGRKEAANAGKLIRAEGIVFDVAYTSVLKR
AIRTLWSVLDEMDQMWLPVHKSWRLNERHYGALQGLNKTETSQKYGEEQVLVWRRSYDTP
PPALGRDDERWPGADPRYRGMAEGEIPLSECLKDTVARFLPLWHETIAPQIRSGKSVAIV
AHGNSLRALVKYLDNISEDDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQDAVKQAVAA
VAGQAKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactggttttgttgcggcatggagagagtcagtggaaccttgaaaacagattc
accggctggcacgacatcgacctgacggaacgcggacgcaaagaggcggcaaacgccgga
aaactcatccgcgcagaaggtatcgtgttcgacgtggcctacacctccgtgctcaagcgt
gccatccgcaccctctggagcgtgctcgacgaaatggaccagatgtggctgccggtccac
aagagctggcggctcaacgaacgccactacggcgccctgcagggactcaacaaaaccgag
acttcgcagaagtacggcgaagagcaggtgctcgtgtggaggcgcagctacgatacgccg
cctcccgctctgggccgcgatgatgaacgctggccgggtgcagacccccgttaccgcggc
atggccgaaggggagatccccctcagcgagtgcctgaaggatacggtcgcccgtttcctc
cctctctggcacgagaccatcgctccccagatccggagcgggaagagtgtagccatcgtg
gcacacggcaactcgctgcgcgctctcgtcaagtatcttgacaacatctcagaagacgat
atcgtcggactgaacattcccaccggcatcccgcttgtctatgagctggacgatgacctg
aaaccgctgaagagttactacctcggggaccaggatgccgtgaagcaggcggtggccgcc
gtggccggtcaggcgaaagcctga

DBGET integrated database retrieval system