KEGG   Chlorobium luteolum: Plut_0534
Entry
Plut_0534         CDS       T00291                                 
Name
(GenBank) amino acid ABC transporter substrate-binding protein, PAAT family
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
plt  Chlorobium luteolum
Brite
KEGG Orthology (KO) [BR:plt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plt02000]
    Plut_0534
Transporters [BR:plt02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    Plut_0534
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan Ion_trans_2 Lig_chan-Glu_bd Ion_trans Phosphonate-bd NMT1
Other DBs
NCBI-ProteinID: ABB23418
UniProt: Q3B5G3
Position
complement(623924..625060)
AA seq 378 aa
MSLNPISSMQTPHRHRLSAMIPHRLALVSLLFMIMLSSACLRTADGTERELKIATKHAPP
FAMQDEHGKWNGLSIDLITAIAEKQGFRATFVPMSLLDMLEAVNRGEVDLAAAALTMTVE
REKQLDFSHPYFQSGLAIAVREKEDGWKYALGRLFSPAFLRILGGLSLLLLLSGFLVWLF
ERRQNPGDFGGGPAEGIWSGFWWAAVTMTTVGYGDKAPKTRPGRMVALVWMFTSLIVISG
FTAAITTSLTVGSLGSGIQEMDDLYGKKVGTLEASTSSSFLEELAIKGQYFPTVKEAMQA
LEKGQIDAVVYDEPILRYMITSGEIHGVRVVERSFKPEYYAFALPPGSPETETLNRNLLG
IINSLAWKEIKYKYLREE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagcttaaacccaatctcgagcatgcagacaccccatcgacaccggctgagcgccatg
ataccccataggcttgccctcgtctcacttctgttcatgatcatgctgtcgtccgcatgc
ctccgcactgcagatgggacggaacgggaactcaaaattgcgaccaagcacgctccccct
ttcgcaatgcaggatgaacacggcaagtggaacgggctttccattgacctgatcactgcc
attgccgaaaaacaggggttccgagccaccttcgtaccgatgagcctcctggacatgctt
gaagctgtcaaccggggggaggtcgatcttgccgccgcagccctcaccatgacggtggaa
cgagagaaacagcttgatttttcccacccctactttcaatcggggcttgccatcgctgtc
agggaaaaggaagacggatggaaatacgccctcggccgcctcttttctcccgcatttctc
cggatactcggcgggctctcgctgttgctgctgctctcaggtttccttgtctggctgttc
gagcgccgccagaaccccggagacttcggagggggaccggctgagggcatatggtcggga
ttctggtgggcggccgtcaccatgaccaccgtcgggtacggcgacaaggcaccgaaaacc
cgtccgggaagaatggtcgcccttgtctggatgttcacgagcctgatcgtcatctccggc
ttcaccgccgccataacgacatccctgaccgtcgggtctctcggcagcggcattcaggag
atggacgacttgtatgggaagaaagtcggtaccctcgaagcatcgaccagcagtagcttc
cttgaggaactggcaatcaagggccaatactttccgacggtaaaagaggcgatgcaggca
cttgaaaaaggtcagatcgatgccgttgtttacgatgaaccgatactccgctacatgata
acatctggggagatacacggagtcagggtagttgaacgttccttcaagcctgaatactat
gccttcgccctgccccctggaagtcccgaaacagaaaccctgaacaggaacctgctcggt
atcatcaactccctggcatggaaagagatcaaatacaaatacctccgggaggagtaa

DBGET integrated database retrieval system