KEGG   Chlorobium luteolum: Plut_1267Help
Entry
Plut_1267         CDS       T00291                                 

Definition
(GenBank) oxaloacetate decarboxylase, alpha subunit
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
plt  Chlorobium luteolum
Pathway
plt00020  Citrate cycle (TCA cycle)
plt00620  Pyruvate metabolism
plt00720  Carbon fixation pathways in prokaryotes
plt01100  Metabolic pathways
plt01120  Microbial metabolism in diverse environments
plt01200  Carbon metabolism
plt01230  Biosynthesis of amino acids
Module
plt_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
plt_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:plt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plut_1267
   00620 Pyruvate metabolism
    Plut_1267
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Plut_1267
Enzymes [BR:plt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Plut_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23 PASTA DUF2118
Motif
Other DBs
NCBI-ProteinID: ABB24129
UniProt: Q3B3F2
Position
complement(1432562..1434409)
Genome map
AA seq 615 aa AA seqDB search
MKRIRFMDVSFRDGFQSCYGARVKTEDFIPALEAAVAAGTDNFEIGGGARFQSLYFYCQE
DAFEMMDAARRVVGPDINLQTLSRGANVVGLVSQSRDIIDLHARMFKKHGITTIRNFDAL
MDVRNIAYSGQCIHNAGLKHQVVIALMGLPPGLKESYCHTPKFYLDKLREILDAGIPFDS
VAFKDASGVTTPTVVYESIKGARAMLPEGTIIEFHTHDTAGMGVACNFAAIEGGADIIDL
AMAPVSGGTAEVDILTMWHRLRGTDYTLDIDPEKYIEVEALFAERMEKYYMPPEAKEVNP
VIPFSPMPGGALTANTQMMRDNNTLHLFPEVIRNMREVVAKGGFGSSVTPVSQFYFQQAF
ANTVQGPWTKITDSYGKMVLGYFGNTPAEPDPEVVRLASEQLGLQPTKEDVHDINDRNPE
LGIAYNRSLLEKAGVPVTEENIFIAATCGAKGISFLQGDKPLGIRYKADVEAEMAAKVAK
KHGTAEPKNVNQRLNELIVKPQKSCMSNYIVTVDGKSFNVSVADGTGAVKPVAEAAPAAV
PSSGEGVPVETSLPGTVMAISVEVGDTVAEGDEIAIIEAMKMESPVKSPRAGKVVSIDVA
VGDTVATGDVLVYIA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatacggtttatggatgtatcattccgtgacgggttccagtcctgttacggc
gcacgggtgaagactgaggatttcatccccgctctcgaggctgccgttgcagccgggacg
gataatttcgagatcggtggaggcgcccggttccagagcctgtacttctactgccaggag
gatgccttcgagatgatggacgccgcccgcagggttgttggtcccgacatcaacctccag
accctttcaaggggtgcgaacgtcgtcggtctggtatcgcagtcgcgcgacatcatcgac
ctgcacgcaaggatgttcaagaagcacggcatcaccaccatccgcaacttcgacgccctg
atggatgtgcgcaatatcgcatactccggccagtgcatccacaatgcgggcctcaagcat
caggtcgtcattgccctcatgggccttcctccgggactgaaggagagctactgccacacc
ccgaagttctacctcgacaagcttcgtgagatccttgacgccggcattccgttcgacagc
gttgccttcaaggacgcttccggcgtgacgaccccgacggtggtctatgaatcaatcaag
ggcgcacgtgcgatgctcccagagggtaccatcatcgagttccacacccatgacaccgcc
ggtatgggcgtggcctgcaacttcgccgcaattgaaggcggagcggacatcatcgatctt
gccatggctcccgtcagcggaggcacggccgaggtcgacatcctcaccatgtggcaccgc
ctgcgcggcaccgactatacgcttgacatcgatcccgagaagtacatcgaggtcgaggcg
ctctttgctgaacggatggagaagtactacatgccgccggaagccaaagaggtcaacccc
gtcatcccgttctcgccgatgcccggcggcgcgcttacggccaacacccagatgatgcgc
gacaacaacaccctgcacctgttcccggaggtcatccgcaacatgcgtgaagtggtcgcc
aagggcgggttcggctcgtccgtcaccccggtttcccagttctatttccagcaggctttc
gcaaacaccgtgcagggcccctggacgaagatcaccgacagctacggcaagatggtgctc
ggctatttcggcaacacccctgcagagcctgatccggaagtggtgcggcttgcatccgaa
cagctcggacttcagccgacgaaagaggatgtgcacgacatcaatgaccgcaaccccgag
ctcggcattgcctacaaccgttcgctgcttgagaaagcaggcgttcccgtcacggaagag
aacatcttcatcgctgcaacatgcggcgcaaaagggatttcgttcctccagggcgacaag
ccgctcggcatccgctacaaagctgatgttgaggctgaaatggctgcaaaggtggcaaaa
aagcatggcacggccgaaccgaagaatgtgaatcagcgtcttaatgaactcatcgtcaaa
ccccagaaatcctgtatgtcaaactatatcgttaccgtggacggcaagtccttcaatgtt
tcggtcgccgatggaaccggcgccgtgaaacctgtcgcagaagcagcacctgcagccgtt
ccttcttcaggtgagggcgttcctgttgaaacctctcttcccggaaccgtcatggccatc
tccgtcgaagtcggtgacacggttgccgagggtgatgagatcgccatcatcgaggccatg
aagatggagtctcccgtcaagtcgccgagggctggaaaagtcgtctccattgatgtcgcc
gtcggcgatacggtggcaaccggtgacgtgctcgtatacatcgcctga

DBGET integrated database retrieval system