KEGG   Chlorobium luteolum: Plut_1676Help
Entry
Plut_1676         CDS       T00291                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
plt  Chlorobium luteolum
Pathway
plt00790  Folate biosynthesis
plt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plut_1676
Enzymes [BR:plt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Plut_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABB24530
UniProt: Q3B2A1
Position
1880481..1881392
Genome map
AA seq 303 aa AA seqDB search
MSPHRPAGTTPPLKCRTRTLDFSEGPKVMGILNTTPDSFHDGGTLTGPEGELDLGLALER
ARRMLSEGADIIDIGGESSRPGARVISTDEEIQRTAPLIELVRRESDAPISIDTYKAAVA
EAALQAGADIVNDISGFSFDSAMPSVCNSYGAAAVLMHTPARPADMQWSTRTPNGSEDIT
ATVMHYLEEAVRRAEAAGVQDIIIDPGFGFGKSVEENFRLLKRLGEFRSTKRPVLAGLSN
KSFLAHIAASGGKPVRPTAERLSATLAAETLAVLNGADIIRTHDAGGAKTCIRVVQAMVG
LHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcatcgcccagccggcaccaccccgccgctcaagtgccgaacgagaacgctt
gatttttccgaagggccgaaagtcatgggcatcctcaacaccacccccgactcgttccac
gacggcgggaccctcaccggcccagagggagaactcgacctcggccttgccctcgaacgc
gcccgcaggatgctcagtgaaggagcggacatcatcgacatcggcggcgaatcctcccgg
cccggcgccagggtaatcagcaccgatgaagagatccagcgcaccgcgccactcatcgag
ctcgtgcgcagggagagcgatgccccgatctcaattgacacctataaagcggcggtggcc
gaggcggcactgcaggccggagccgatatcgtcaacgacatctccgggttctcgttcgac
agcgccatgccctccgtctgcaacagctacggggctgcagcggtcctcatgcacacgccg
gcaaggcctgcagacatgcagtggagcacccggacaccgaacggcagtgaagacatcacc
gccaccgtcatgcactatctcgaagaggccgtgcggcgcgccgaagcagcaggggtacag
gacatcatcatcgaccccgggttcgggttcggcaaaagcgtagaagagaacttcaggctt
ctcaagcggctcggggagttccgctcgacaaagagaccggtgcttgcagggctctcaaat
aaatctttcctcgctcatattgccgcgtccgggggaaagccggtacggccgacagctgaa
cggctcagcgcaacccttgccgccgaaaccctcgccgtccttaacggcgcagatatcatc
cggacccacgacgcaggtggtgcgaaaacctgcatcagggtagtgcaggctatggtgggt
ctgcatgggtag

DBGET integrated database retrieval system