KEGG   Chlorobium luteolum: Plut_2038Help
Entry
Plut_2038         CDS       T00291                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
plt  Chlorobium luteolum
Pathway
plt00860  Porphyrin and chlorophyll metabolism
plt01100  Metabolic pathways
plt01110  Biosynthesis of secondary metabolites
plt01120  Microbial metabolism in diverse environments
Module
plt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:plt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plut_2038
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plt01007]
    Plut_2038
Enzymes [BR:plt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Plut_2038
Amino acid related enzymes [BR:plt01007]
 Aminotransferase (transaminase)
  Class III
   Plut_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABB24880
UniProt: Q3B1A1
Position
2268216..2269511
Genome map
AA seq 431 aa AA seqDB search
MPTHTRSAELFEKAKKFIPGGVNSPVRAFKSVGGNPIFMAKGQGAYMTDVDGNTYLDYVG
SWGPFILGSMHPRITAALEHTLTKIGTSFGTPIEMEIEIAELLTKIVPSIEMVRMVNSGT
EATMSAVRLARGCTGRDKIIKFEGCYHGHGDSFLIKAGSGALTLGAPDSPGVTKGTAEDT
LNAKYNDIKSVELLVAENKGNIAAIIIEPVAGNTGVIPAKKEFLQALRDLCDREGIVLIF
DEVMCGFRVALGGAQELYGITPDLTTMGKIIGGGLPVGAFGGKRSLMENVAPLGGVYQAG
TLSGNPLALTAGIETLKILMEENPYPELDRKGAFLEAGFRDNMQKLGLNFVQNRVGSMAC
LFFTETPVESYDSAITADTEKFGKYFSSMLEQGIYLAPSQFEAMFTSTMHTDADLEKTVK
ANYVALQAATK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacacaccagatcagccgaactctttgaaaaggcaaagaagtttatccccgga
ggcgtcaactcgccggtccgggccttcaaatccgttggaggcaaccccatcttcatggca
aagggccagggcgcttacatgaccgatgtggacggcaacacctaccttgactatgtcgga
tcatggggaccgttcatcctcggcagcatgcacccgaggatcaccgcagcccttgagcac
accctcaccaaaatcggcaccagcttcggaaccccgatcgagatggaaatcgagatcgcc
gagctccttaccaaaatcgtgccatccatagagatggtccgcatggtcaacagcggaacc
gaagccaccatgtcggccgtccgccttgcccgaggatgcaccggccgcgacaagatcatc
aagttcgaaggctgctaccacggccacggcgacagcttcctcatcaaggcaggctccggt
gccctgaccctcggcgcccccgacagcccgggtgtcaccaagggaaccgccgaggatacc
ctgaacgcgaagtacaacgacatcaagtcggtcgaactcctcgttgccgagaacaagggc
aacatcgcagccatcatcatcgagccggtcgccggcaacaccggtgtcatccctgcgaag
aaagagttcctccaggcgctgcgcgatctctgcgaccgcgaaggcatcgtcctgattttc
gacgaggtgatgtgcggcttccgcgtagccctcggcggtgcgcaggaactctacggcatc
accccggacctcaccaccatgggcaagatcatcggcggcggccttcccgtcggcgcattc
ggcggcaagcgcagcctgatggagaacgtagccccgctcggcggcgtctaccaggccggt
accctgtcgggcaacccgctcgcactcaccgccggcatcgaaaccctgaaaatcctcatg
gaagagaacccctacccggaacttgatcgcaagggcgccttcctcgaagcgggattcagg
gacaacatgcagaagctcggcctgaacttcgttcagaaccgcgtgggctccatggcctgc
ctgttcttcaccgaaacaccggtggagagctacgacagcgccatcaccgcagacaccgaa
aagttcggcaagtacttcagctccatgctcgagcagggcatttatctcgctccctcgcag
ttcgaagcgatgttcacgagcacgatgcacaccgatgccgacctcgaaaagacggtcaag
gcgaactacgtcgcgctccaggccgcaacaaagtaa

DBGET integrated database retrieval system