KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu0873Help
Entry
plu0873           CDS       T00149                                 

Gene name
folK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00790  Folate biosynthesis
plu01100  Metabolic pathways
Module
plu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    plu0873 (folK)
Enzymes [BR:plu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     plu0873 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: CAE13168
Pasteur: plu0873
UniProt: Q7N868
Position
complement(999913..1000428)
Genome map
AA seq 171 aa AA seqDB search
MARVYIAVGSNLAEPMQQVKNALAALKDLPETECIACSSLYRTKPMGPQNQPDFLNAAVA
LETTLAPEELLNHTQAIELTQGRVRKDERWGPRTLDLDIMLFGDQVINTERLTVPHYGLK
QREFMLYPLAEIAPDLIFPDGEALSERLKHIPENGLALWLQPQSSDSNHYI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgtttatatcgctgttggtagcaatctggcagaacctatgcagcaagtaaaa
aatgcacttgctgcattaaaagatttaccggaaacagaatgtattgcctgctcctcactg
tatcgtactaaaccgatggggccgcagaatcaacctgattttctgaatgcagcagtcgca
ctggaaaccacgctagcaccggaagaattactcaatcacactcaggcgattgaactgacc
caaggacgggtaagaaaagatgaacgctgggggccaagaacacttgatctggatatcatg
ctatttggtgatcaagtgattaataccgaacgcttaacggtaccccactacggactaaaa
cagcgcgaatttatgctctacccgttagctgaaattgcccctgatcttatatttcctgat
ggggaagctttatctgaaagactgaaacacatcccagaaaacggcttggcactctggctg
caaccgcagtcctctgattctaatcactacatatag

DBGET integrated database retrieval system