KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1049
Entry
plu1049           CDS       T00149                                 
Symbol
pilL
Name
(GenBank) Some similarities with PilL protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: TcpQ
Other DBs
NCBI-ProteinID: CAE13344
Pasteur: plu1049
UniProt: Q7N7Q9
Position
1227925..1228974
AA seq 349 aa
MKNPVFFSLSWVLVMVLAGCAGQTQEATASGVSFHRSHQASPAVSDIYSLTPEVTRYDRY
TLVSVGSQAVQREPLNQIINITMPVPLVQRIGDGLHYLLFGTGYSLCDTTATHFVKLIGR
PLPAIQRKMGPIRLSEALQIVVGPAWRIRVDEVNREVCFVLRDEYRQFSETTVGRITQPK
MRVPLQIASSPALSASTLSNSTLATPLPVKPLIAERPKTDTLQSSVTGGKSTTISSVSPT
QPIKSLLSGSTPVATVPIGNIWRAETGTTLRGTLERWANTTDCPVGGHWVVVWSSPTDYR
IDAPLMFKGNFESLLVQVFDLYRQAEKPLFAEVSRLQCLISVSDKPVTR
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaaaaccctgtttttttctcactcagttgggtgctcgtcatggtattagctgggtgt
gccggacaaactcaggaggctaccgcatccggtgtaagttttcaccgttctcatcaggca
agtcccgctgtatccgatatctattctctgacaccagaagttacacgctatgatcgctat
accttggtgagtgtaggcagccaggctgtgcagcgtgaacccctcaatcaaatcatcaat
atcaccatgccagtaccattggtacaacgcattggtgatggattgcactatctgcttttt
ggaacaggttattcgctgtgtgataccaccgcaacccatttcgttaaattgataggcaga
ccattaccggctattcaacgcaaaatggggccgatacggctcagtgaagcgttacagatt
gttgtcgggccagcatggcgtatccgggtagatgaggtgaatcgtgaagtgtgttttgtt
ttacgtgatgaatatcgtcagttttccgagacaacggttggccggataacacagcccaaa
atgcgggtaccgttgcaaatagcttcttcaccggcgttatcggcatctacattgtccaat
agcacattagccacgccgttaccggtgaagcccctgatagctgaaagaccgaaaacagat
acccttcaatcttctgtgacaggagggaaatccacaaccatttcttcagtatcacctact
cagcccattaaatccctgctgagcggcagtacaccagtggcaacggtaccgataggcaac
atctggcgtgcggaaacaggaaccactttgcgtggaacgttggagcggtgggctaataca
acggattgcccggtagggggacactgggtagtggtgtggtcgtcaccgacggattaccgc
attgatgcgccgttgatgttcaaaggcaactttgagtccttgttggtacaagtgtttgat
ctttatcgacaggctgagaagccattgtttgccgaagtcagccgccttcagtgcctgatt
tcagtcagtgataaaccggtgacccggtaa

DBGET integrated database retrieval system