KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1069
Entry
plu1069           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: CAE13364
Pasteur: plu1069
UniProt: Q7N7P2
Position
1244457..1245029
AA seq 190 aa
MTEGMAAAVKQVVPPGYQQIARVHGVPVEMLYALALAESAKRLPQEKHERPWPWTLNVAG
KSYRYATRQAVWQALQGFMRSVPLKRIDVGITQVNLGWNGHYFRSYWDALDPYTNLHVAA
RILKTCYQSNPGSWLNAAGCYHHPAGGQPASKYRKIVARKLSTLETRYPVLSTNIAVVNT
TQTWIEPKEK
NT seq 573 nt   +upstreamnt  +downstreamnt
gtgacagaaggtatggccgcggcggtaaaacaggttgttccgcctgggtaccagcagatt
gcgcgggtgcatggcgtacccgttgaaatgctttatgcgttggcactggctgaatcggca
aaacgtttgccacaggagaaacatgaacgcccctggccgtggacgctcaatgtggctgga
aaaagttatcgttatgcaacccgacaggcggtctggcaggcgttgcagggatttatgcgc
agcgtacccctcaaacgtattgatgtggggattactcaagtgaatttaggctggaacggc
cattattttcgttcttattgggatgccttggacccctatactaatcttcatgtggcagct
cgtattctgaaaacctgttatcaatccaatccgggtagttggttgaatgcggcaggctgt
tatcaccatcccgctggcggtcaacccgcgagtaagtatcggaaaatcgtcgcacgtaaa
ctgagtacgctagagacccgatatcctgttttgtccaccaatattgctgtagttaatacg
acacagacctggattgaaccgaaggaaaaataa

DBGET integrated database retrieval system