KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1070
Entry
plu1070           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: DUF2859 Mucin Xre_MbcA_ParS_C DUF4780
Other DBs
NCBI-ProteinID: CAE13365
Pasteur: plu1070
UniProt: Q7N7P1
Position
1245035..1245571
AA seq 178 aa
MLIHNLIRYRCRLFLMMMILTPCSQAALTIVADLGGQSTAAYFDAINAQDNEPTTSSNTE
ATPPDLTEGGILPVETPELSPGPVDARPLQLPGMGALFMIGDDARSKQWLKENLVGLRKK
QAVGLLVSVRDKAQLDELRQLAEGLVLAPASGSDLARRLNLRHYPVLITDIGLTQQVR
NT seq 537 nt   +upstreamnt  +downstreamnt
atgttaatccataacttaatccgttatcgctgccgtttatttttaatgatgatgatattg
acgccctgttctcaggctgcactgactattgtggctgatttaggtggacaatctacagca
gcgtattttgatgccattaacgctcaggacaatgaaccgacgacttcttcaaatacggag
gcgaccccgccagatttgaccgaagggggcattttaccggtggaaacgccggaattgtct
cccggacctgttgacgctcgtccgttgcaattgccaggaatgggagcgttgttcatgatt
ggggatgatgcccggtcaaaacagtggttgaaggaaaatttggttggccttcggaaaaag
caggcggtggggttgctggtcagtgtgcgggataaagcacaactggatgaactgcgtcag
cttgcagagggattagtattagcccccgcttccggcagtgatttggcccggcggttgaat
ttgcggcattacccagtgttgataaccgatatcggtttaactcagcaggtgcgttga

DBGET integrated database retrieval system