KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1081
Entry
plu1081           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: DUF3487 PrgI YtxH
Other DBs
NCBI-ProteinID: CAE13376
Pasteur: plu1081
UniProt: Q7N7N5
Position
1252813..1253190
AA seq 125 aa
MVQTIRFLPDRLNAEPVVFRGFTTPELGWTALTGLIAGAVIGLLLASVTGWVMIPTAALI
APLLLIAFGGKYLARMKRGKPAHYLYRRLEVKKRCWGLGDPLLIITSQRWSLRRRHRVMT
RMGRL
NT seq 378 nt   +upstreamnt  +downstreamnt
atggttcagactattcgttttttacctgaccgtcttaacgccgaacctgtcgtgttccgg
ggatttactaccccagaactgggctggacggcattaacgggattgatagctggcgcggtc
attggcttgttactggcatcggtaacggggtgggtgatgataccgacggcggcactgatt
gcgccgttgttattgattgcctttggcggcaaatacctggcccggatgaaacgcggtaaa
ccggcgcattatctctatcgacggctggaggttaaaaagcggtgctggggtctgggtgac
ccgttactgattatcacctcacaacgctggtcattgcgccgccgtcaccgggtaatgacc
cgaatggggcggttatga

DBGET integrated database retrieval system