KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1082
Entry
plu1082           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: CAE13377
Pasteur: plu1082
UniProt: Q7N7N4
Position
1253840..1254763
AA seq 307 aa
MNKQVLVELLALTALLFAGLVMVSPVEAVELMKWERIPLPVALHVGQERVVFVDKNVRVG
FPGALDGKLRIQSTGGAVYLYPSETFTQTRLQLQDVESGEVILLDVTATNGKDPLEPVRV
VYHGDVITLTDDHQIHHGAKGDNTSATSPSLAGERQAARRQKPSYTAPLPVVLTRYAAQS
LYAPLRTVEAVPGIHPVSLALSPRLTTLYPSAPVIVSPLGGWGVDNLTVVALKVRNTHRE
NVVLDPRRLQGQFIAATFQHRWLGPSGTPEDTTTVYLVVKGRPDRAFLPEPVRSKTPMKR
QGNPHAN
NT seq 924 nt   +upstreamnt  +downstreamnt
gtgaacaaacaggtactcgtcgagttattggcattgaccgcattattattcgccgggctg
gtgatggtttcacccgttgaggccgtggagttgatgaagtgggagcgtatcccgctgccg
gttgccttgcatgttgggcaggagcgggtggtttttgtagataaaaatgtccgagtcggt
tttccgggtgcgctggatggcaaattgcggatacaaagcaccggtggtgcagtgtatctg
tatccgagtgaaacgtttacccagacccgactgcaacttcaggatgtggaaagtggggaa
gtgattttactggatgtgacagctacaaatggaaaagatccccttgagccggttcgggtg
gtgtaccacggggacgtgattacgttgacggatgaccatcagattcatcatggtgccaaa
ggggataacacgtcagcaacgtctccctctcttgccggtgaacgtcaggccgcccggcgt
caaaaaccgtcctatacggctccgctgccggtggtcctgacccgttatgctgcgcagagt
ctgtatgcgccgttgcgtacagtagaagctgttcccggcattcacccggtatcattggca
ttgtcgccccgattgaccacattgtatccctctgcgccggtaatagtttccccgttaggg
ggctggggggtggataacctcactgtggtggcgctgaaagtgcgtaatacccaccgtgag
aacgtagtgcttgatccacgcaggttgcaggggcaattcatagcagcgacctttcagcat
cgttggttggggccgtcgggtacgccggaagacacgactaccgtctatttggtggtgaaa
ggtcggcctgaccgtgcctttctgcctgaaccggtgaggtcaaaaacgcctatgaagcga
caaggaaatccccatgcaaattaa

DBGET integrated database retrieval system