KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1083Help
Entry
plu1083           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Mod_r DDE_Tnp_IS66 Ecm33 Nup54
Motif
Other DBs
NCBI-ProteinID: CAE13378
Pasteur: plu1083
UniProt: Q7N7N3
Position
1254753..1256231
Genome map
AA seq 492 aa AA seqDB search
MQIKSNGLVKWVVPAFVIAGLVVGIKSCRQSETPVSQTVSHQALAELSSGELRALGIEGD
TPEDTLRTLIGALRSIRVQQAALEKQNAQLLADNEKWRNGSQSMTDQINRVVAGTREETE
KQQQLLKAEQQTLFSRLDQLTRQLGNKGMNINNSLVERDIPLGLGLDNTGQNTTSGGDRL
VWITPQDTLPVDSQVAMSGQPASPRFPVSFLEDNALSRQKVEYDGITKNQRAITEDHTNE
IIRPVYTLPENTTLVGSQAMTALLGRVPVNDKVTDPYPFKVLIGKDNLTANGIELPDVEG
AIVSGMATGDWTLSCVRGNVTSLTFVFADGTVRTVPKSDNRTNGSHHVQDNSSGGIGWLS
DNNGIPCISGERKSNASSYLPTLFALSGGTAAGDVLSQSQLTTQTNGYGGATSSLTGDAG
KAVLGQAAAGGFKAVSEWVKARYGQTFDAVYVPPGARVAVHITQQIPIDYEERGRRVKYN
LGLGQEVRDGLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagtcaaatggtctggtgaagtgggtcgtgcctgcttttgttattgcgggg
ctggtcgtggggatcaagagttgtcggcaatcagagacgcctgtcagccagacagtgagt
catcaggctttggcggaactgtcttccggggagctgcgggcattggggattgagggggat
accccggaagacacgttgcgcaccttgattggagctttgcgcagtatccgtgttcagcag
gcggcgctggaaaaacaaaacgcacaattactggcggacaatgagaaatggcgaaacggc
agtcagagcatgactgaccagattaaccgggtggtagcgggtacccgtgaggaaacagaa
aagcaacagcagctattgaaagcggagcagcaaacgctgttcagccgacttgaccagttg
acccgtcagttaggcaataagggcatgaatataaacaactctctggttgagcgtgatatt
ccgctgggattagggttggacaataccggccaaaatacgacctctggcggggaccggttg
gtctggattaccccacaggatacgttaccggttgattcacaggttgcaatgagcggtcag
ccagcgtccccccgttttcccgtgtcatttctggaggacaatgcattgagccgtcagaaa
gtggaatatgacggtataactaaaaatcagcgagccattaccgaggatcatacaaacgag
attatccggcccgtttataccctgcccgagaatacgacgctggtcggcagccaggcgatg
actgcattattaggccgggtgccagtaaatgacaaagtcactgacccgtatccttttaag
gtactgattggtaaagataacctgactgccaacggcattgaattgccggatgtcgaaggg
gcgattgtttctggtatggctaccggtgactggaccttgtcttgcgtgcgcggcaatgtc
acatctttaacttttgtctttgcagacggtaccgtcagaactgtgccgaaatcggataat
cgcaccaatggcagccatcacgttcaggataatagcagcggtggtatcggctggctatct
gacaacaacggtattccgtgtatcagcggtgaacgtaaatccaatgcatccagttattta
ccaaccttatttgctctttctggtggcacagctgcgggcgatgtgttgtcacagagtcag
cttaccacccagactaacggttatggcggtgcgacgtcatcactgaccggggatgccggt
aaagcggttttggggcaagccgctgccggaggatttaaggccgtatccgaatgggtcaaa
gctcgttatggccaaacttttgatgccgtttacgtaccgccgggtgccagagtagccgtg
cacattacccagcaaataccgattgattatgaagagcggggacgcagggtgaaatataac
ttaggtcttggacaggaggtccgtgatggtctggactga

DBGET integrated database retrieval system