KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1085
Entry
plu1085           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: TraC_F_IV HerA_C AAA_22 FBPase_glpX AAA_29 FtsK_SpoIIIE AAA_7
Other DBs
NCBI-ProteinID: CAE13380
Pasteur: plu1085
UniProt: Q7N7N1
Position
1256643..1259525
AA seq 960 aa
MMWSLLNKVRLRKWDNLSEVLGETEVILPSSSTVVGREPLRRPGKMTSTDEAALYDTWPS
IIDYLPWVEYLDDEKCLLLDDGLSVGAIYAVSPVSTEGRTTARLEDIRDQVEDALQDSLE
DDDVSPWVVQFFCQDEDDPALYLTQLRQYIKPWAQGSAFTEAWLAETERHLKGIARPEGL
FNDSLVTGQSWRGQQRRTRMVIYRWAPVGQKESLLPIVLLNQVCDRLTASLASTGILCQR
QNGEQVHHWLLRLFNPDPDWIDKATLYQAASYATPQAGERKPDNDFTETLWFTPPRSDVK
NGVWWFDNIAHRAVPVERLRRPPEPGTLTGEMVRGENINALMDLLPSGTIVSLTVVAQAQ
DTLEQDFDRLSKNAVGENTESGRVRSDVKEAKAHLGLRHKLCRSALTFLLQGADVDDLNR
RHQQLAATLLVSGLQPVKPECDVAPLNGYLRALPMCFNPQRDKHHWYTRLTWMQHVAGLL
PVTGRATGTGNPGLSFFNRGGDVLTFDPQNKHDRTQNAHLLLFGPTGAGKSATLCASLSQ
LMAVHCPRLFVAEAGNSFGLFADYCQRLGLSVNKISIKPGCGVSLALFADAHQLLQVASS
QLDLAGERSAEETADDEADEQRDILGEIELAARMMITGGEKKEEERLTRADRGMIREAIM
IAARASFDDGRQMIAEDLQNALSVIARDSRRDEQGRALCTEQRRARAEEMAGAMSMFTSG
FEGELFNRPGTPWPEADVTLIDLGTLAREGYSAQMALAMVSLVNTINNMAERDQFDVREI
NFVVDEAHVLTTNPLLSPYMTKVVKMWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLC
LTMPPDEVEQIARFKKLSEEQKSVLLSASKLPGCYTEGVVLSKKVEALFRVVPPSVYLAL
GMTEKEEKAERRAIMKTLHCSELDAAFVVARRLDRARGLISGEVADGRDEDLLSMQECRL
NT seq 2883 nt   +upstreamnt  +downstreamnt
gtgatgtggtcgctgttgaataaagtccgcttgcgtaaatgggataatctatcggaagtt
ttgggtgaaactgaggtcatactaccgtcgtcttctaccgttgttgggcgtgaacctttg
aggcgtcccggcaaaatgaccagcacggatgaagctgcgttgtatgacacttggccgtct
atcattgattacctgccttgggtcgaatatttggacgatgagaagtgtttgttgctggat
gatggtctttcagtcggcgctatttatgctgtttccccggtatcgacagaaggacgcact
actgcccgtctggaagatattcgtgaccaggtagaagatgcgttgcaagacagtctggaa
gacgatgacgtatctccctgggtagtgcagtttttttgtcaggatgaggatgatcccgcg
ttatatctgacacaacttcgtcagtatattaaaccttgggcgcagggttcagccttcact
gaagcttggttggctgaaaccgaacgtcatctgaaggggatagcccgaccagaagggctg
tttaacgattcattggtgactggtcagtcctggcggggacagcaacgtcgtacccggatg
gtcatttatcgttgggcccctgtcggacagaaagaaagcttgctacccattgtgttgctt
aatcaggtgtgtgaccgactgacagcttcgctggctagtacaggtattttgtgccaacga
caaaatggtgaacaggttcatcactggttactgcgattattcaatcctgatccagattgg
atagacaaagcgacgttgtatcaggcagctagttatgctaccccacaggctggtgagagg
aagccagataatgatttcacggaaaccttgtggtttaccccgccacgttctgacgtgaaa
aacggtgtatggtggtttgataatattgctcaccgagcggtaccggttgaacggctgcgt
cgtccaccagagccgggaacgctgaccggtgaaatggtcagaggggagaatatcaatgca
ctgatggacttattaccctcaggaactattgtttcgctgactgtggtcgcacaagcacaa
gacacgctagaacaggatttcgaccggttgtcaaaaaatgccgtgggagaaaatactgaa
tcagggagagtacgttcagacgtaaaagaagctaaggcacatctggggctgagacataaa
ctgtgccgttctgcactgacctttctgttacagggggctgatgttgacgatttgaaccgt
cggcatcagcaactggccgcaaccctgttggtatcggggttgcagccggtcaaacccgaa
tgcgacgtcgcgccgttaaacggttatctgcgtgccttaccgatgtgttttaacccgcaa
cgagacaaacatcactggtatacccggttgacttggatgcagcatgtggctgggttgttg
ccggtgacagggcgggcgaccggcacaggcaacccgggtcttagcttttttaaccggggc
ggtgatgtgctgacatttgatccgcaaaataaacatgaccgtacccagaatgcgcatctg
ttgctgttcgggccgaccggtgcggggaagtcggctacgctctgtgcgagtttatcgcag
ttgatggcggtgcactgtccccgattatttgtggcggaagcgggcaacagttttgggctg
tttgccgattactgtcaacgcctggggctgagtgtcaacaaaatcagcattaaaccaggt
tgtggtgtcagtctggcgctgtttgccgatgcccaccaattgcttcaagtggcatcttct
cagttggatttggcgggtgaaaggtcggcagaggaaaccgcagatgacgaggccgatgag
cagcgcgatatcctgggagaaatagaacttgcggcgcgcatgatgatcaccggtggggag
aagaaagaggaagaacgtctgacgcgggcggatcggggcatgatacgtgaagccatcatg
atagcggcgagagccagctttgatgacggccgacagatgattgcggaagatttgcaaaat
gcattgtctgtgattgcccgggacagccggcgggatgaacaggggagagcattgtgtacc
gaacagcgtcgggcccgtgctgaagagatggcgggggcgatgtcaatgttcaccagtggt
tttgagggggaattgtttaatcgtccgggaacaccttggccagaagccgatgtaacgcta
attgatctcggtacgctggcgcgtgaaggatatagtgcgcagatggccttggcgatggtg
tctctggtcaataccatcaacaatatggcggaacgtgatcaatttgatgtaagggaaatt
aattttgttgtggatgaggcgcatgttctgaccactaatccgttattgtcaccttatatg
accaaagtggtcaagatgtggcgaaaattaggggcctggttgtggctggctactcagaat
ttggcggactatccggatacggctgagaaaatgctcaatatggcggagtggtggttgtgt
ttgacaatgccgccggatgaagtcgaacagatagcgcgttttaaaaagctgtctgaagaa
caaaaatcggtgttgctatcagccagcaaactcccgggttgttacaccgaaggcgtggtg
ttgtcgaaaaaagtggaggcgttatttcgggtggtgccgcccagtgtgtatctggcgctg
ggcatgacggagaaagaggaaaaggcagagcgcagggcgattatgaaaacgcttcattgc
agcgaattagatgctgcctttgttgtggcgcgaaggctggaccgtgcccgtggtctgata
tctggggaagtggcggatgggcgtgatgaggatctcttatccatgcaggagtgcaggcta
tga

DBGET integrated database retrieval system