KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1087
Entry
plu1087           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein. Hypothetical secreted protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: TraU T2SSM_b
Other DBs
NCBI-ProteinID: CAE13382
Pasteur: plu1087
UniProt: Q7MB68
Position
1259929..1260927
AA seq 332 aa
MKSLDLPSLTWHSRLKKFGMVLILTVVLAPVAVASVNTAQIVSSAASVSCISWRIKGLCY
WLLCSPWGCKVRTSIKVAHFIPQAVVSVYNAPGGNPWREMSLVSQTVDGVENAVTRALSG
IAVGGGNHQLKIPGNRKNNLHFKYADAIGHPATAMMGGKISGYACKSAATPFMPYFLSTL
DSLVWRTGVPESFYPEALIPGKRELGNSFRGNMWGNVYPRSGFVTQQDDNKAAAVVAQRV
ADIITRTGQGHVYQSLQGNHKQGYWPPGEVVENTVNQNHQWQRIAPKMSTSCAVFPDNSG
EAAKDGNYVFALWQPYSCCQRRGQTFLYSTDF
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaagtctctagatttaccgtcattaacatggcattcccggctgaaaaagttcggtatg
gtcctgatactaacggttgttttggcgccagtggccgttgctagtgtgaatacggctcag
attgtgtccagtgccgcgtcggtatcgtgcatcagttggcggataaaaggtctctgttac
tggctgctgtgttctccctgggggtgtaaagtgcgtacctcgataaaagttgcgcatttt
attcctcaggccgtggtctccgtctataacgcgcctggcggtaatccctggagagaaatg
tctctggtcagccagactgttgacggcgtggaaaatgccgtaacgagagcactttccggg
atagccgtggggggcggtaatcatcagctgaaaatcccaggcaaccgaaaaaacaatctg
cattttaaatatgccgatgcgattgggcatccggcaactgccatgatgggcggaaaaatt
tcggggtatgcgtgtaaaagtgccgccacgccttttatgccttactttttgagtacgctg
gacagcctggtttggcggaccggtgtgccagagtcgttttatcccgaagcgcttattcca
ggcaaacgtgaactgggtaattcgtttcggggcaatatgtggggcaatgtttatccgcga
agcgggtttgtgacacaacaggatgataataaagcggctgcggtggtagcgcaacgggta
gcagacattatcacccgtactggacaggggcatgtttatcaatccttgcaagggaaccac
aaacagggttactggccaccgggcgaagtcgttgagaatacggttaaccaaaatcatcaa
tggcaacgtatagcgccgaaaatgagcacctcttgtgctgtttttccggataacagcggg
gaagcggccaaggacgggaattatgtctttgcattgtggcaaccctacagttgttgtcag
cggcgtggacagacttttctttacagtaccgatttttga

DBGET integrated database retrieval system