KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu1088
Entry
plu1088           CDS       T00149                                 
Name
(GenBank) unnamed protein product; Similar to unknown protein
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
SSDB
Motif
Pfam: HisG_C
Other DBs
NCBI-ProteinID: CAE13383
Pasteur: plu1088
UniProt: Q7N7M9
Position
1260943..1262370
AA seq 475 aa
MRQRLFLPVLIALAFMTVPVVRAAGFAIADSPIGYGKSLNGAVSDKLFYNIGGGSVISQP
ATRSHLQHLGGLNLGWSSDLMCGNFDLKTTVGNQLNGLTSGFKNLMGEVIQGATGAVASL
PAMVIQRANPGLYEMLTNGVLQAGIAFDKSQLSCQNMSQRMMDFSDSSKWTKAALMEEYK
TLVNTGNGDAVGTTQKMEVADGTQGSNWIGGEKRGGKGQKAIQPIRDLAKAGFNMMNNLP
ANSHANVNRTQCNGAACQKFKNSEEAADAVVKVLGDRSVRTCTDSRQCTSGDTKDQPGAS
VAGTGFAPMLEEATRTNIEQLMKLVSGENAPTIVNLAKLKTGSLMVTRGVIQALKRDPDS
GALVSRLASELAMADTVETALTMRRMLMTGQAEPNAAAQAQAMAESDRRIATLDREITAL
KNEMELRRAIAQNTALTTLEREQNRVEMNLQRQSTDNTDSRIHTLSVPPKGREGQ
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagacaacgattatttttgcctgtattgatagcactggcgtttatgactgttcctgtt
gttcgggcggcaggttttgccattgcggacagcccgataggttacgggaaaagcctgaat
ggggcggtatcggataagttgttttacaacataggtggcggatcagtgatatcgcagccg
gcgacccgcagtcatctgcaacatctgggcggattaaacctcggttggagcagtgacctg
atgtgcggtaactttgatttgaaaacgacggtagggaatcagcttaatggcctgacttcg
gggtttaaaaacctgatgggggaagtgatacaaggggctactggggccgtagctagttta
cccgcaatggttatccagcgtgctaatccgggattatatgaaatgctgaccaacggggtg
ttacaggcaggtattgcgttcgacaaatcacaactgagttgccagaacatgtcacagcgt
atgatggatttctcggatagcagtaaatggactaaagcggcgttgatggaggaatataaa
acgttggtgaataccggtaatggtgatgcggttggcacgacacaaaaaatggaggttgcg
gacggtacacaaggttcaaattggattgggggtgaaaaacggggaggaaaagggcagaaa
gcgattcagcccatccgggatctggcaaaagccggcttcaatatgatgaacaacctgccg
gcgaatagccatgccaatgtcaaccgcacacaatgtaatggcgctgcttgccagaaattc
aagaacagtgaagaagccgcagacgcggtcgtcaaggtgttaggtgatcgttcggttcgt
acctgtactgacagtcgtcagtgtaccagtggggataccaaagaccagccgggtgcaagt
gtcgctgggacggggtttgcaccgatgctggaagaggctaccaggaccaacattgagcaa
ttgatgaaactggtcagcggggaaaatgcgcctaccatagtcaatctggcaaaactcaaa
acaggtagcttgatggtgactcgcggggttatccaggctctgaaacgtgatccggacagt
ggggctttggtgagtcggttggccagtgagttggcgatggccgacaccgttgagactgcg
ctcactatgcgacgaatgttgatgaccggccaggcagaaccgaatgccgccgctcaggcg
caggcgatggcagagagtgatcgtcgcattgcgacactggacagagaaattactgccctg
aagaatgaaatggagttgcgccgggcgattgcacaaaataccgccctgaccacgcttgag
cgcgaacaaaatcgagttgaaatgaatctgcaacggcaatccaccgataataccgacagt
cgtattcacaccttgtccgtgccgccgaaagggcgtgaagggcaataa

DBGET integrated database retrieval system