KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2079Help
Entry
plu2079           CDS       T00149                                 

Gene name
luxC
Definition
(GenBank) Fatty acid reductase
  KO
K03400  long-chain-fatty-acyl-CoA reductase [EC:1.2.1.50]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu02020  Two-component system
plu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    plu2079 (luxC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    plu2079 (luxC)
Enzymes [BR:plu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.50  long-chain acyl-protein thioester reductase
     plu2079 (luxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxC Aldedh
Motif
Other DBs
NCBI-ProteinID: CAE14372
Pasteur: plu2079
UniProt: Q7N577
Position
2463107..2464549
Genome map
AA seq 480 aa AA seqDB search
MTKKISFIINGQVEIFPESDDLVQSINFGDNSVYLPILNNSHVKNIIDYNENNKLRLHNI
VNFLYTVGQRWKNEEYSRRRTYIRDLKKYMGYSEAMAKLEANWISMILCSKGGLYDVVEN
ELGSRHIMDEWLPQDESYIKAFPKGKSIHLLAGNVPLSGIMSILRAILTKNQCIIKTSST
DPFTANALALSFIDVDPNHPITRSLSVVYWPHQGDTSLAKEIMQHMDVIVAWGGEDAINW
AVEHAPPYADVIKFGSKKSFCIIDNPVDLTSAATGAAHDICFYDQRACFSAQNIYYMGNQ
YEEFKLALIEKLNLYAHILPNAKKDFDEKAAYSLVQKESLFAGLKVEVDVHQRWMIIESN
AGVEFNQPLGRCVYLHHVDNIEQVLPYVQKNKTQTISIFPWESAFKYRDALALRGAERIV
EAGMNNIFRVGGSHDGMRPLQRLVTYISHERPSHYTAKDVAVEIEQTRFLEEDKFLVFVP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaatttcattcattattaacggccaggttgaaatttttcccgaaagtgat
gatttagtgcaatccattaattttggtgataatagtgtttacctgccaatattgaataat
tctcatgtaaaaaacattattgattataatgaaaataataaattacggttgcataatatt
gtcaattttctctatacggtagggcaaagatggaaaaatgaagaatattcaagacgcagg
acatacattcgtgatttaaaaaaatatatgggatattcagaagcaatggccaagttagag
gccaactggatatctatgattttatgttctaaaggtggcctttatgatgttgtagaaaat
gaacttggttctcgccatatcatggatgaatggctacctcaggatgaaagttatattaag
gcttttccgaaaggtaagtctatacatctgttggcaggtaatgttccattatctgggatc
atgtctatattacgcgcaattttaaccaagaatcagtgtattataaaaacatcgtcaacc
gatccctttaccgctaatgcattagcgttaagctttatcgatgtagaccctaatcatccg
ataacgcgctctttgtctgttgtatattggccacaccaaggtgatacatcactcgcaaaa
gaaattatgcaacatatggatgttattgtcgcttggggaggggaagatgcgattaattgg
gctgtagaacatgcaccaccctatgctgacgtgattaaatttggctctaaaaagagtttt
tgcattattgataatccagttgatttaacgtcagcagctaccggtgcggctcatgatatt
tgtttttacgatcagcgcgcttgtttttctgcccaaaacatatattacatgggaaatcag
tatgaggaatttaagttagcgttgatagaaaaacttaatctatatgcgcatatattacca
aacgccaaaaaagattttgatgaaaaggcggcctattctttagtccaaaaagagagctta
tttgctggattaaaagtagaggtggatgttcatcaacgttggatgattattgagtcaaat
gcgggtgtggaatttaatcaaccacttggcagatgtgtgtatcttcatcacgtcgataat
attgagcaagtattgccttatgttcaaaaaaataagacacaaaccatatctatttttcct
tgggaatccgcatttaagtatcgagatgcgttggcattaagaggtgcggaaaggattgta
gaagcaggaatgaataatatatttcgagttggtggatctcatgacggaatgaggccgtta
caacgattagtgacatatatttctcatgagaggccatctcattatactgctaaggatgtt
gcggttgaaatagaacagactcgattcctggaagaagataagttccttgtatttgtcccg
taa

DBGET integrated database retrieval system