KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2171Help
Entry
plu2171           CDS       T00149                                 

Gene name
ureA
Definition
(GenBank) urease gamma subunit
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00220  Arginine biosynthesis
plu00230  Purine metabolism
plu01100  Metabolic pathways
plu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    plu2171 (ureA)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    plu2171 (ureA)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    plu2171 (ureA)
Enzymes [BR:plu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     plu2171 (ureA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_gamma
Motif
Other DBs
NCBI-ProteinID: CAE14464
Pasteur: plu2171
UniProt: Q7N4Y9
Position
2557998..2558300
Genome map
AA seq 100 aa AA seqDB search
MQLTPREIEKLMVYTLADVALKRKSRGLKLNYPEAVAIITAAALEGAREGKTLEEVMDDS
RHVLTKEDVMDGVADLIPHVQVEAIFTDGSRLVTVHDPIQ
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaacaccaagggaaatcgaaaaactcatggtatatacactggctgatgtcgca
ttaaagcgtaagtctcgcggtttaaaactcaattatcctgaagccgtcgcaattattact
gcggctgcattggaaggtgcccgagaggggaaaacattggaagaagtgatggatgattcc
aggcatgttctgactaaagaggatgtgatggatggcgttgctgatcttattccgcatgta
caggttgaagcaatatttactgatggtagtcgtttggtcacggtgcatgaccccattcaa
taa

DBGET integrated database retrieval system