KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2200Help
Entry
plu2200           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein and to glutamyl-tRNA(Gln) amidotransferase chain A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00970  Aminoacyl-tRNA biosynthesis
plu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    plu2200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:plu03029]
    plu2200
Enzymes [BR:plu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     plu2200
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     plu2200
Mitochondrial biogenesis [BR:plu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    plu2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF5474
Motif
Other DBs
NCBI-ProteinID: CAE14493
Pasteur: plu2200
UniProt: Q7N4W4
Position
2587792..2589135
Genome map
AA seq 447 aa AA seqDB search
MDEIISLSINELGERIRSGVISPVEILGEYMKRILCYDHKLNAFSEIYEADARAAAKHAE
QEIRSGNWRGPLHGIPFAVKDFFDLKGKVTGGGTNCFSQKAYVTAPVVATLLKQGMILTG
KHRAVELGMGATGIMENSPTPLNPWGQSQRVAPGGSSNGSAVAVAAGLTPIALVTDTGGS
ARIPAAWCGVSGFRPSMGNLSSSGMLPLSQTMDTVGIIAKHASDIFIVYNQLNPNLAYHS
CINNLNIGILPSEEYILDKETGLHYVSLLEVFSQMGMVTQKKPFPYPLSQCMKANSIITA
FEAWQNYGYLCNSQNSLSDTIKVRLERGKEIKEKEYSEALIFCRHVRKIFSNWFQNVDAL
VIPTTPEPSWPIAEKDEHQPPNDFTRFVNFADLCAVSIPTGLNSQGLPFSLQIVCNRKKE
KNALALAELIECRIGFSNTELKIRLKT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaattatcagtctttcaattaatgaattaggagaaagaatacggagcggagtg
atatcacctgttgagattttaggtgagtacatgaagcgtattttatgttacgaccataag
ctgaacgccttttcagagatctatgaagctgatgcgcgggccgcagcaaaacatgccgaa
caggaaatacgatcaggaaattggcgtggtcctctccatggtattccttttgctgttaag
gatttttttgatctgaaaggtaaggtcacaggaggaggcacgaactgttttagtcaaaaa
gcatatgttacggcaccagtggtagccaccctcttgaaacagggaatgattctgacagga
aaacacagagcagtagagctcggtatgggagcaacgggcatcatggaaaatagcccgacg
ccactcaacccttggggacaatcacagagagttgctccaggcggctcaagcaatggctca
gctgtagcagtggcagccggtttgacaccgattgctcttgtaactgacacggggggatct
gcacgtatacctgccgcttggtgtggcgtaagtgggtttcggccatcaatgggcaatttg
tcatcatcaggtatgcttccattaagccagacgatggatactgtgggaattattgccaag
catgcatctgatatattcattgtttataatcagctgaacccaaatttagcgtatcattca
tgcattaataatctgaatattggcatattaccgtcagaagaatatattttagataaggaa
acaggtttgcattatgtgtcattgctggaagttttttctcaaatgggtatggtaactcaa
aagaaacctttcccatatcctttatcgcagtgcatgaaggctaattctatcattactgcg
tttgaggcttggcagaattatggatatttgtgtaattcacagaactccctcagcgataca
attaaagtaagattagaacgtggcaaagagataaaagagaaagagtattcggaagcattg
atattctgtcgtcacgtacggaagatattttcgaattggtttcagaatgtggatgcttta
gtaattcctacaaccccagaaccttcttggcctatagctgaaaaagatgaacatcaaccc
ccaaatgacttcacccgtttcgtaaactttgctgacttatgcgcggtctccatcccaaca
ggattaaacagtcaggggttaccattttcattacagatcgtatgtaaccgaaaaaaagaa
aaaaacgcccttgctcttgcggaattgattgaatgccgtatcggtttcagcaatacagaa
cttaaaatacgactcaagacatga

DBGET integrated database retrieval system