KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2288
Entry
plu2288           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Some similarities with unknown protein and putative macrophage toxin
  KO
K11891  type VI secretion system protein ImpL
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    plu2288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu2288
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu2288
SSDB
Motif
Pfam: IcmF-related_N
Other DBs
NCBI-ProteinID: CAE14581
Pasteur: plu2288
UniProt: Q7N4N7
Position
complement(2687306..2690815)
AA seq 1169 aa
MKKLFYAIGWLSVMVILLLLSLTIAVAFSWPTIGGLLLFICLLLLLLLLRVAMAFMPEIM
NKLRWLNKFWRKGNNRLEYLLYQHWRQGGYLQSWRRFRSLLHRNEPVPPWFLVVGERGNG
KQKLLTRCNVVPMTGKNLPALTENTFTCRWWFFRRAMYMVVSGRYTEGQSLYRQAWLRLI
SWIAQVRKPAGVLVCLSVEQLLNSDNRALYIAARQVRAQLEPLQIRLERRLPIWLILTHS
ETLPGFDHWCTQLSVEQHAELLGDFIEHHTVGNVTDVLDKSMNTIVNTLKMMRLKLLNQQ
RQQPNAEILALPETVAQLQPALGCYLNALFDQDHYLEHGLLRGLFFTAEHQTAGVFSQRL
LGEYLPDQVQHSQDQRSHNVLLTGWRTLTKRVCVSLLSLMLVYGVGNALMTTWRGVTQLE
NIHEADPLERSYLRYQKVEYWLQETLPSLFFYPVTHTMEQRMAQQYQQQAPVGAFNPESV
AAHLLARFHNAETPQKRLLVLHWARFINIEQAMTHGATLETLQRMPAYSASLLSGENDPL
SAEQRVALRLAQYRQGNAQQAFDQWRNVLQTLLEDSNNWQWLLADEQPTGTHSLTLADFW
PLASDDVATINTRIRGIYTQAGEQDIQATLGELAQALNRPAFFTPLQRSFYQQYQNQRQS
EWLAFAQAMPQGEMLVRGKKNWQALILAAGQYDSPYITFLTQLERDLSSIEQADRQPWLQ
TQQRLWQLHGYVQKSGMMQRVSLGNFSVRQRIMSWLGISPQISVRLDDTALTRYRAYRQA
VQLNSQRELLSDMETEVLVKNALNNEKGELDDSGLRALFNRFTLWHHETESKQSAGVNET
LWRLYQGDAHLVLRYAFLSAASRLQTQWESKVIWPMEKLSRQELFDGRELNARLYEYSNA
FVRDTAGYALDIRPEGIKRQEIEDVVFPFSDDFIFYINNLIQPNDLLSATSDIRRRLQEK
LALLESEQQLTTAQQEPEQEQKPSAEVTIVSQPATANRGAKVLPVGSSVTLSCDDGVQQL
KSMNFNDSMTLHWSPGTCGKVQIDIYFPRFTLSKSYIGSDGLLQFMHAFSRGELTLAAQA
FPQRRDELSALGINNITVRYQVSESTAVSTLYQQWQQHQQQQTALLEQRNRLDSQLLNLS
EPTVAKGTLSTLPSQITTHWNELRKPKSE
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgaaaaaattattttatgccattggctggcttagcgtgatggttatccttttattactc
agtttaactattgcggtggcattttcatggccgacaataggtggtttattactatttatt
tgcctattactgttgttattattgctgcgtgtggcaatggcattcatgccagaaataatg
aataaactgcgctggttaaataaattctggcggaaaggaaataaccgtctggaatattta
ctctatcagcactggagacaaggaggatatttacaaagttggcgtcgattccgttcactg
ttacaccgtaacgaacccgttccaccgtggtttctggtggtaggggaacggggcaatggt
aaacagaagttgttaacacgctgcaatgtggtgcccatgacggggaaaaatctgccagcg
ctgacagaaaacacctttacctgtcgctggtggttcttccgccgggcaatgtacatggtt
gtttccggccgttataccgaaggtcaatccctgtaccggcaagcctggttgcgtctaatc
agttggatcgcacaagtacgtaaacccgctggcgtactcgtttgcttatcggtggaacag
ttgctaaacagcgacaatagagcgctctatatcgccgcacgtcaggtacgtgctcagttg
gaaccattacagatacgtctggaacgccgcttacccatctggctgatccttacccacagc
gaaacattgccggggtttgaccattggtgcacccaactgtcagtagaacaacatgctgaa
ttgctaggcgattttatcgagcatcatacggtgggtaatgtcaccgacgtgctggataag
agcatgaacaccattgttaacacgttgaaaatgatgcgccttaagttgctcaatcagcaa
cggcagcaacccaatgcagaaatcttagcgttaccagaaacggtagctcaactgcaacct
gcactgggttgttacttgaatgcactgttcgaccaagaccattatctggagcatggtctg
ttgcgtggcctgttttttaccgccgagcatcaaactgctggcgttttcagccaacgtttg
ttgggagaatacctgccagatcaagttcaacatagccaagatcaacgtagccataacgta
ttgctgactggctggcggacattgaccaaacgcgtatgcgttagcctactcagtttgatg
ctggtgtacggtgtcggcaatgcattgatgacgacctggcgtggcgttacgcaacttgaa
aatatccatgaggcagacccgcttgagcggagttacttgcgctaccaaaaagttgaatac
tggttgcaggaaaccttgccatctctgtttttctatccggtcacccatacgatggaacaa
cggatggcacagcaataccagcaacaagcacctgttggtgcattcaacccggagtcggta
gcggcacacttactagcacgtttccataacgcggaaacaccgcaaaaacgactgttggtt
ttacattgggcacgctttattaacatagaacaggcaatgacacatggcgctacgctagaa
actttacagcgtatgcctgcttattcagcttcactattaagtggtgaaaacgatccttta
tccgcggaacaacgcgtcgcacttcgtctggcgcaatatcgccaaggcaatgcacagcaa
gcatttgatcagtggcgaaatgtattgcaaacactactagaagatagcaataactggcag
tggctattagccgacgaacaaccgactggcacgcattcgctgacactggctgatttctgg
ccgctcgccagcgatgatgttgccacaattaacacacgtattcgtggtatctatacccaa
gcaggtgagcaagatattcaggcaaccttaggagaactggcacaagcccttaacagaccg
gcattctttactcctttacagcgctcgttttatcaacagtatcaaaatcagcgccaatca
gagtggttagcattcgctcaggctatgcctcaaggagagatgttagttcgaggcaagaaa
aactggcaagcgctgatattagcagcgggccaatatgacagcccctatatcacctttctg
acccagctagaacgtgatttatcctcgatagagcaggcggatcggcagccttggttacag
acacagcagcgtttatggcaactgcatggttatgtgcaaaaaagtggcatgatgcaacga
gtctcgctagggaatttctctgtgcgccagcgcatcatgtcatggcttggaatttcaccg
cagatctcggtacggctggatgataccgcgctgacacgctatcgcgcctaccgacaggcg
gtgcagttaaatagccaacgcgagttgctcagtgatatggaaaccgaggtgttggttaaa
aatgcgctaaataacgagaaaggagagttggatgatagcggtttacgcgcattgtttaac
cgtttcaccctgtggcaccatgagactgaaagcaaacagagtgcaggagtaaatgaaacc
ttatggcggctctatcagggtgatgcgcatctggtactgcgttacgccttcttaagtgct
gccagccgcttgcaaactcagtgggaaagcaaagtgatttggccgatggaaaaattgagc
agacaggaactgtttgatggccgggaattgaacgcgcgtttgtatgaatacagcaatgca
tttgtacgggataccgcagggtatgcgctggatatccgtcctgaagggattaaacgtcag
gaaatagaggatgtagtctttccgtttagcgacgatttcattttctatatcaataacctc
attcaaccgaatgacctactttcagcgacatcggatattcgccgtcgtctgcaagagaaa
ctcgccttattggaaagcgaacagcaactgacgacagcacagcaggaaccggagcaagaa
cagaagccatcggcggaagtaaccattgtcagtcagccggcgaccgctaaccggggggca
aaagtattgccagtaggcagttcagtgacgttgagttgtgatgatggcgtacagcagctt
aagagtatgaatttcaatgacagcatgacgctgcactggagcccaggaacatgcggtaaa
gtacaaattgatatctattttcctcgctttaccctaagcaaaagttacattggctccgat
ggtttgctgcaatttatgcacgctttctcccgcggtgaactgacattagcagctcaagcg
ttcccgcaacggcgggatgaattaagtgcgctgggtatcaataacatcactgtgcgctat
caagtcagcgaaagcacagcggtttcaacactctaccaacaatggcagcaacatcagcaa
caacaaacggcgttattggaacaacgcaaccgactggatagccagttgttaaatttaagt
gaacctacagtggcaaagggaactctctctactttgccatcacagatcaccacccattgg
aacgaattaaggaaacctaaaagtgagtaa

DBGET integrated database retrieval system