KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2290Help
Entry
plu2290           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu2290
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: CAE14583
Pasteur: plu2290
UniProt: Q7N4N5
Position
complement(2691451..2692848)
Genome map
AA seq 465 aa AA seqDB search
MFEHKPMYWYSGLYLQPQHFQAHELQHEYWQGRYQLLTQPYAFGVVKLAFNLAALSDEVL
SVHHAAFIFPDGGYVDCDVNGVLSARSLRDCWPVRDKPQRIYVGLRMFSHNQNNVTGITD
ANGVGNITSRWVTWPQEQRMRDAFGEGPEAEVQQLTYNLRFFLHDEIAQATGYTLLPVGQ
LHCTSDGIALDNRYLPPCLTLYAVPQLGQRIDQLCQELTGRIHQLEELKRPQTLEGEIYT
QEKSTLLLTLRTLARYVVQLHHFQEARDVHPLQIFGLLRQLISELSCFTDRCSFLGQWNG
QEEVLEKYQHLDLALTLDSCERTIADLLNALVLEPNTVISLQQESRGYYHATFNTTGSNE
QQRLYLVLRSDSFTHREREIPDDRLIKLAAAEQIDNIINRALPGVRLYYQEIAPHGLPNR
ANTCYFRLENRGALWQQVEESKRVAVHWADAPDDLQTEIVIVRAS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacataaaccgatgtattggtattcaggattatatttacagccgcaacacttt
caggcccatgaattgcaacatgaatactggcaaggacgttatcagttactgacacaacct
tatgcttttggtgtggtgaaactcgcattcaatctggccgcgctaagtgatgaagtactg
agtgtccatcacgccgcgtttatttttcccgatggtggttacgtggattgtgatgtcaac
ggcgtactcagtgcccgatcattgcgggattgctggccggtacgtgacaaaccgcagcgc
atctatgttggcctgcgcatgttcagccacaatcagaataacgtcaccggtatcacggat
gccaatggtgtcggtaatatcaccagccggtgggtaacatggccgcaagaacagcgtatg
cgggatgcttttggcgaggggccggaagcggaagtgcaacaattgacctataacttacgt
tttttcttgcacgatgagattgctcaggcaacgggttatacactattaccggttggccaa
ctgcactgcaccagtgacggtattgcgctggataaccgctatctaccgccatgtttgacg
ctctatgctgtgccacaactgggccagcgcattgatcaactgtgtcaggagttaaccggg
cgtatccatcaattggaagagttgaaacgcccgcaaacactggaaggggaaatttatact
caggaaaaaagcacattattgctgacactacggactctggcgcgttatgtcgtacagttg
caccattttcaggaagcgagagatgttcaccccttacagatttttggattattgcgccaa
ctgatcagcgagctttcctgttttaccgaccgttgctcctttttaggccagtggaacggg
caggaagaggtactggagaaatatcagcatctggatctggcgctaactcttgatagttgt
gaacggacaattgccgatttgcttaatgcgctggtgctggaacccaataccgtgatctct
ctgcaacaggaaagccgtggttattatcatgcaaccttcaatacaacggggagcaatgaa
cagcaacggctctatttggtgctgcgttctgacagctttactcatcgcgagcgtgaaatt
cctgatgatcgcttgattaaactggcggcggcagaacagatcgacaacattattaaccgt
gctttgcccggtgtacgtctgtactaccaggaaattgcgccacatggtttacctaaccga
gcaaacacctgctatttccggctagaaaatcgcggtgcattatggcagcaggtagaagag
agcaaacgtgtggcagtgcactgggcagatgcgccagacgatttacaaacagaaatcgtt
atagtgagagcgtcatga

DBGET integrated database retrieval system