KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2301Help
Entry
plu2301           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein
  KO
K11901  type VI secretion system protein ImpB
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu2301
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: CAE14594
Pasteur: plu2301
UniProt: Q7N4M4
Position
complement(2702952..2703503)
Genome map
AA seq 183 aa AA seqDB search
MNTQRKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFAEQSIPMRERRFMQVDKD
NFNAVMEGLSPSLELQVESALPGQSGFMNVDLQFKSMADFTPENLAKQIEPLRHLLEVRG
KLSDLKGRALSNEKLRDRLAEILAEHADKLPQANEEAETAAIENRADDVTPENSNIPENN
NAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaacgtaagcttgataaagtcagaccgccccgagttcagattacttatgat
gttgaattaggtggcgcggtcgagaaaaaagaattgcctttggttattggcgttattggg
caatttgctgagcaatctattcccatgcgtgaacgtcgttttatgcaggttgataaagat
aattttaatgcagtgatggaaggtttatcaccttcattggaattacaggttgaaagtgcg
ctgccgggtcagagcggatttatgaatgtcgatttgcaatttaaatcaatggctgacttt
accccagagaatttggcgaaacagatagaaccgcttcgtcatttattagaggtacgcggc
aaactcagtgatttgaaaggccgtgcattgagcaatgaaaaattgcgtgaccgtctggcg
gaaattctagctgaacatgcggataaattaccgcaagcaaatgaagaagcagaaaccgct
gccatagaaaatagagcagatgacgtcaccccggaaaatagcaatatcccggaaaataac
aatgcacagtga

DBGET integrated database retrieval system