KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2722Help
Entry
plu2722           CDS       T00149                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase (SDAP)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00300  Lysine biosynthesis
plu01100  Metabolic pathways
plu01120  Microbial metabolism in diverse environments
plu01230  Biosynthesis of amino acids
Module
plu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    plu2722 (dapE)
Enzymes [BR:plu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     plu2722 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18 DEK_C
Motif
Other DBs
NCBI-ProteinID: CAE15096
Pasteur: plu2722
UniProt: Q7N3J4
Position
3229410..3230537
Genome map
AA seq 375 aa AA seqDB search
MTCPVIELAQQLIRQPSISPDDKGCQDIMIAHLQTIGFTIERMPFGDTNNFWAYRGIGPT
LAFAGHTDVVPAGDESQWEYPPFEPTIRNGMLYGRGAADMKGSLAAMIVAAERFVAAHPN
HNGRLAFLITSDEEAKATHGTVKVVEALMSRNERLDYCLIGEPSSQHRLGDMVKNGRRGS
LTANLTVHGIQGHVAYPHLADNPIHRVLPALQTLVNTHWDEGNEFFPATSMQIANIHAGT
GSHNVIPGNVQVQFNFRFSTELTDSQIREQVETILKNHNLNYTIEWILAGQPFLTAKGEL
VNAVIQSIDQYCGYQPELSTSGGTSDGRFIAQMGAQVVELGPLNSTIHKVNESVSAADLQ
QLSRIYQRVMEQLIQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttgccctgtcattgaacttgcacaacaactcatcagacaaccctctatcagcccg
gacgataaaggttgccaagatattatgatcgctcatttgcaaacaattggctttaccatt
gaacggatgccctttggcgatacaaacaatttttgggcctatcgcggcataggcccgacg
ttagcctttgccggacacactgatgtcgtccctgcgggcgatgaatctcagtgggaatat
cccccatttgagcccactatccgtaatggcatgttatatggtcggggtgcggcagatatg
aaaggatcattagctgccatgattgttgcggctgaacgtttcgttgccgcccatcccaac
cataatggacgtctggcctttcttattacttcagacgaggaagcgaaagccacccacggc
accgttaaagtggttgaagccttgatgtcccgcaatgaacgattggattattgcctgata
ggtgaaccttctagccagcaccgtcttggcgatatggtgaaaaatggccgtcgaggttcc
ctgacggcgaatctcactgttcacggtatccaaggccacgttgcctatccgcatttagct
gataaccctatccaccgtgtccttcctgctttacagacattggtcaatacacattgggat
gaagggaacgaatttttcccggcgaccagtatgcaaattgccaatatccacgcgggaaca
ggcagccacaatgtgatccctgggaatgtgcaagttcaattcaatttccgtttcagtaca
gaactgactgacagccaaatccgtgaacaggttgaaactatcctcaaaaatcacaatctc
aattacacgattgagtggatactggcaggtcagcctttcctaacagccaaaggtgagtta
gtcaatgccgtcatccagtcaatagaccaatattgtggctatcaacctgaattatctacc
agtggtggtacatccgatggacgatttatcgctcagatgggcgctcaagttgtcgaactg
gggccactcaactcaacaattcataaagttaatgagtccgtcagcgccgccgatctgcaa
caacttagccggatttatcaacgtgttatggagcagttaatccagtga

DBGET integrated database retrieval system