KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2770Help
Entry
plu2770           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to asparagine synthetase B AsnB of Escherichia coli
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00250  Alanine, aspartate and glutamate metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    plu2770
Enzymes [BR:plu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     plu2770
Peptidases [BR:plu01002]
 Cysteine Peptidases
  Family C44
   plu2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 ATP_bind_3 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CAE15144
Pasteur: plu2770
UniProt: Q7N3E7
Position
3282784..3284316
Genome map
AA seq 510 aa AA seqDB search
MCGIGGVFNTENRLIDDIENKLQTIMSKIAHRGDPSRFNEKVVRNNFSIATNRLAIVERD
SAYQPISNQEHDLHLVLNGQIYNYKSLRNELIKQGYQFKNGGDAEVALIAYICYGKSFIK
KLDGMFSFILFDNKNNKFLLGRDHVGIKPLYYTQKEGNWYVASEIKSLIEFNSEIKPVEP
GSIFDGLTSEKYISYDTTIPASSDNVEQAKEKIYSLLDNAVRKRVDTDLPVSIMFSGGID
STIVLYLAKKYHHDITAISFGLPGSKDIEIAQRYCTENNIKHIIYTFTQEELINNIQDAI
YYGEFFEQIDAIDSTIAHFGYYIANRLGFKIALCGEGSDEIFAGYDLFKTYPDPHHLSLY
RLNNLHRTDLQRVDRASMRNTVEARVPFMDSALVPYVLSLDFSYKLNNGIEKYILREAFR
GKIPEYIIDRPKIRMPDGSGVKNTIIDYVKDIKCNLPRNMVDSLNSIGLTHQSSLYFAEK
YLSLGYPLPKERFKESGKDFSESGYFNFIS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattggtggtgtttttaatacagaaaataggcttattgatgatattgaaaat
aagctacagactataatgtcaaaaatagcacatcgtggcgatccatctcgatttaatgag
aaggttgtcagaaataacttttcaattgcaaccaacagacttgctattgtcgaacgcgat
tcagcctatcaacccatatcaaatcaggaacatgatcttcatcttgttctgaatggtcaa
atttataattacaagtctcttcgaaatgaattaattaaacaaggttatcaatttaaaaat
gggggcgatgcagaagttgccctaattgcctacatttgctatggcaagtcatttattaaa
aaattagatggcatgtttagttttattctatttgataataagaataataaattcttatta
ggcagagatcacgtcggtataaaaccgctctattacacccaaaaagagggtaactggtat
gtagcctcagaaataaaatcattaatcgaatttaactcagaaattaaacctgttgaaccc
ggttcaattttcgacggattgactagtgagaaatatattagctacgacacaactatccca
gcaagcagcgataacgtcgaacaggcaaaagaaaaaatctattcactgttagataatgcc
gtcagaaagcgggttgacacagacctgccagtgtcaattatgtttagcggcggcatagac
agtactatcgtgctttatcttgcaaaaaaatatcaccacgatattacggcgatttcattt
ggattaccgggttcaaaagacattgaaattgcccaacgatattgtactgagaataatata
aagcatattatatatacatttactcaggaagaattaatcaataatatccaagatgctatc
tattatggtgaatttttcgaacaaatcgatgcgattgattcaactattgctcactttggc
tattatattgctaaccgtcttggctttaaaattgctttatgtggagaaggtagtgatgaa
atttttgctggttacgatctatttaaaacataccccgatccccatcacctctccctatat
cgattaaataatcttcataggactgatttacaaagagttgatcgggcaagcatgagaaat
actgttgaagcaagagttccctttatggattcagcactagtgccttatgttttaagcttg
gatttttcttacaaactcaataatgggatagaaaaatatattttacgcgaagcattcaga
ggaaaaatacccgaatatatcattgacagaccaaaaataagaatgccagatggcagtggt
gtaaaaaatactatcattgattacgttaaagatattaaatgcaatctaccgagaaacatg
gttgacagccttaattctatcggattaacccatcaaagttcattatatttcgctgaaaag
tatctctctttgggttatccactaccgaaagaacgttttaaagaatctggcaaagatttt
tcagaatcgggttactttaatttcatatcgtaa

DBGET integrated database retrieval system