KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu2987Help
Entry
plu2987           CDS       T00149                                 

Gene name
cbiP
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00860  Porphyrin and chlorophyll metabolism
plu01100  Metabolic pathways
Module
plu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:plu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    plu2987 (cbiP)
Enzymes [BR:plu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     plu2987 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA Peptidase_S51 GATase SNO
Motif
Other DBs
NCBI-ProteinID: CAE15361
Pasteur: plu2987
UniProt: Q7N2T7
Position
complement(3488683..3490221)
Genome map
AA seq 512 aa AA seqDB search
MGLSLMLQGTASDVGKSVLVAGLCRIFVQDGYRCAPFKSQNMALNSGITINGEEMGRAQI
FQAEAAGIEPDVRMNPVLLKPTSERKAQVVLMGKVACSMNAVEYHQYKPSLQQQICEVFH
SLASEYDVIVLEGAGSPAEINLRDRDIVNMGMAEMVDAPVLLVADIDRGGVFAAIYGTLA
LLRPAEKARVKGVIINKFRGDISLLQPGIEQIEALTGVPVLGVMPWLDIDLEDEDGVALQ
TGKYDGATEKALDITVIRLPHIANFTDFNALAVQPDVRLRYVTQPSALQPSDLIILPGSK
NTLGDLQWLRQNGLADALLTAHQAGVPVIGICGGYQMLGKRIIDGVESGIEQMDGLGLLD
METRFAHEKVTTRVNGNCLLALPGLLSECVEQPIRGYEIHMGSSLLGADATPFIDITERN
GQSGGWCDGAVNREGSVMGSYIHGLFDSANFTRALLNALRQRKGLAAYQGEILDYTHYKQ
TQFDLLAKAMREHLDIERIYQCMKTHRQGSVP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtctttaatgttgcagggtacggcatctgatgttggaaaaagtgtactggtt
gcgggattgtgccgtatctttgttcaagatggttatcgctgcgcaccgtttaaatcacag
aatatggcgctgaattctggtatcactattaacggtgaagagatgggaagggcgcagatt
tttcaagcagaggcagcgggtattgaaccggatgtacggatgaatccagtattgcttaaa
cccaccagcgagcgtaaagcgcaagtggtgttaatgggaaaagtggcttgtagcatgaat
gcggtggagtatcaccagtataagcccagtttacagcagcaaatttgcgaagtttttcac
agtctggcgagtgaatatgacgtcattgtgctggaaggggctggcagtccggcggagatc
aatctgcgagatcgagatattgtcaatatggggatggcggagatggttgatgcccctgtg
ctgttggtcgcggatattgatcgcggcggcgtatttgcggccatttatggcacattggca
ctgctacgcccggcggagaaagcgcgggtaaaaggggtgatcatcaataaattccgaggt
gatatcagcctgctccagccgggtattgaacagattgaagctttaactggcgtgcctgta
ttgggcgtcatgccttggttggatattgatctggaagatgaagacggcgtagcgctacaa
acgggcaaatatgatggcgcgacagaaaaggcgctggatattaccgtgattcgtttgcct
catattgctaattttactgactttaatgcgctggcggtgcaaccggatgttcgcttgcgt
tatgtgactcaaccatccgcgttgcagccgtcggatttgatcatcttgcccggtagcaaa
aacacattgggagatttgcaatggctgagacagaacgggttagcggatgccttgttaacg
gcacatcaggctggtgttcctgttatcggtatctgcggtggttatcaaatgctggggaaa
cggatcattgatggggtggagtcgggtattgaacagatggatggtctcggattgttggat
atggaaacccgctttgctcatgaaaaagtaacgactagggtaaacggtaactgcttgtta
gcattacccggtttgctgtcagagtgcgttgagcagcctattcgtggttatgaaattcat
atgggcagctcattactgggagcggatgcaactccgtttatcgatattaccgagcgtaac
ggccaatctggtggttggtgtgatggtgcggttaatcgagaaggcagtgtgatgggcagt
tatattcatggcttatttgatagcgctaattttacccgagctctgcttaacgctttgcgt
cagcgcaaaggattggcggcttatcaaggggaaatactggattatacccactacaaacag
actcagtttgatctcctggcgaaagccatgcgcgaacatctggatatagaacggatttat
caatgtatgaaaactcatcgacaaggttcggttccgtga

DBGET integrated database retrieval system