KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu3223Help
Entry
plu3223           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Weakly similar to unknown protein. Putative secreted protein
  KO
K11906  type VI secretion system protein VasD
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    plu3223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu3223
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: CAE15597
Pasteur: plu3223
UniProt: Q7MB16
Position
complement(3810485..3811024)
Genome map
AA seq 179 aa AA seqDB search
MLTIPFYKMVPVMATIALLLTGCGLTQTVTDGTAAATRSFFHKRVKTLHLDFIPRAAVNT
DTGESVALSVPALVRVYQLRDNNAIKKVDYADLLDDGDRILGADCLASEEVVVKPGSHAS
LDMPMAAQAKYVAVVGLFRNPDVAKGTWRRIIKRNELLPDSPRIIALNAGGLTLLPEKG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatccctttttataaaatggtgccggtaatggcgacgatagcattactactg
acaggctgtggtctgactcagaccgtgactgatggcacggcagcggccacccggtccttt
tttcataagcgggtgaaaacgttgcatctggattttattccacgggcagcggttaatacc
gacacgggagaaagtgttgctctgtccgttccggcattagttcgggtttatcagttgcgg
gataacaacgctataaaaaaggtggattatgcggatttgttggatgacggcgaccggata
ctgggcgctgattgtctggcgagtgaagaggtagtggtgaaaccgggtagtcacgcatcg
cttgatatgccgatggcggcgcaggcgaaatatgtggcggtggtgggattattcagaaac
cccgatgtagccaaagggacttggcgtcggatcataaaacgcaacgagttgttaccagat
agtcctcgtattattgcgcttaatgccggtggcttgactttattacctgaaaaggggtga

DBGET integrated database retrieval system