KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu3224
Entry
plu3224           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to unknown protein
  KO
K11895  type VI secretion system protein ImpH
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu3224
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu3224
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAE15598
Pasteur: plu3224
UniProt: Q7N268
Position
complement(3811002..3812090)
AA seq 362 aa
MGRTTLSEHSRLMAILESEISTLDFYQFCQMIERAVPDRPPLGSTENPVDDAIRLRPHPG
LGFPASELKAIETDSEHPERPPTARTNFMGLYGVDSSLPTAYLNDIVQQREGNETIEAFL
DIFNHRMFTQFYRIWRKYSYPATFATGGTDRTSQCLLGLIGLGIPGSQQQIATPMSRFLA
LLSVMRLPTRTAEGVSALVALLAPQTRIVVTPACPRQIHLMQPANLSDTHRISLSQRTVL
GRMGTDINSQLLLALHTDCPDEAWGWLPGGQLHTDFLVLLRVYLGWRYQARLQLTLPTRI
LPPPLLGGQPVRLGLTGVLGLKAENHQLAVPDNITVNLGCYQGISPDSNQDKGGDYVNYP
FL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggaagaacaacactgtcagaacattcccggttgatggcaatactggaatcggagatt
tcgacactcgatttctaccaattctgtcagatgattgaacgtgcagttcctgatcggccg
cctctggggagtacggaaaatccggttgatgatgcgatacgtttgcggcctcatcctggt
ctgggatttcccgccagtgaattgaaagcgatagaaactgacagtgaacatccagagcgt
ccaccgacagccagaacaaactttatgggactgtatggagtagattcttcgttgccaacc
gcttacctgaacgatatcgttcagcaaagggaagggaatgaaactatcgaagcctttctg
gatatttttaaccaccggatgttcacccagttttatcgtatctggcgtaaatactcctat
ccggcaacttttgctaccggaggaaccgatagaacctcccaatgtctgctcggattgatt
ggcttagggataccgggtagtcagcaacagattgccacgccgatgtcccgttttctggcg
ctgctcagtgttatgcgtctgccaactcgaaccgctgaaggcgtatcggcgctggtggca
ttgttggcaccgcaaacccggatcgtggtgacacctgcttgcccgcgacagatccatctg
atgcaaccggcgaatctttcagacactcaccgaatttccctctcgcagcgtaccgtgcta
ggcagaatgggcactgatatcaatagccagttattgctggcgctgcataccgattgcccg
gatgaagcgtggggctggttgccgggcgggcagttgcacactgattttttggtgttgtta
cgggtttatttaggctggcgataccaagccagattgcaactgactctgccgacccgaata
ttaccgccaccgctgctaggtggtcagcctgttcggttagggctaacaggagtattaggg
ttaaaggctgaaaatcatcagctagcagtgcctgacaacattacggtgaatttggggtgt
tatcaggggatatcaccagacagcaatcaagacaaagggggagattatgttaactatccc
tttttataa

DBGET integrated database retrieval system