KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu3231Help
Entry
plu3231           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Similar to putative membrane protein of Y. pestis
  KO
K11891  type VI secretion system protein ImpL
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    plu3231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu3231
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: CAE15605
Pasteur: plu3231
UniProt: Q7N263
Position
complement(3819697..3823068)
Genome map
AA seq 1123 aa AA seqDB search
MKVNRHHQYGYFGYIFITLSLAGIFLMLIYLNQTLLEERGLLKSVWYAYATVFPILLIGL
FGNAVWWHIRQNKAQKKLRPETERTADRSSQSALVLSDLGDRMRLRYGRFWWYKVRILLV
VGEVEQVEAIAPGLTTTHWQEGYRTLLLWGGSLQAEPNTAQLMALRRLRRYRPLNAIVWA
LTENQSAQPVWMDKALRMLQKQAQQLRWQAPVYLWQVCHSTWSQEGRITQTVGCFFPERC
TPDIVATQLQTLVDPLRERGMQQLLEKTAHDFLCRLSANLKQQGIAHWQQVLTPWLAEYG
DVVSLRGLMFSLPLKAQTTRLPQIWLPDTAWQGVLEGSRCFHGRRVGMLHTQTVCRGLIV
LGLLWGAGMMLSFFTNRDQLAVVQAAVTDLKVQPENSDAQLMALKDLRNEVDRLQDRAEH
GVPWYERFGLSQNQKLLTAVLPDYAQVNNRLIRDKAAAVLHAKLSALVNLPPGSPLRAKR
AQAGHDQLKAYLMMARPEKVDAVFLTRILDENEPERAGIAPGVWLDTAWDLWSFYAENLA
AHPEWRITADKALIKQVRQLLLLQPGKHNAEAALYQQMLQSVEKNYSDLTLRQMTGDTDA
ARLFTTSHVIPGMFTRQAWEGGIQKAIAKAVASRKEAIDWVLSDNRQAVSASVSPEELKA
RLTARYFTDFARVWQDFLNSLRWNKTRNLSDVIDQLTLMADGRQSPLIALMNTLAYQGET
GQQGPSLSDSLVKSAKTLLNKKTPRMINQQTAGLHGPMDETFGPLLALMGENQAEGRIKA
DSTLNLQTFLTRVTDVRLKLQQMNNSDDPPAMANALAKTVFEGKSTDLTDTQGYGRLIAA
SLGGQWRSFGQTLFVEPLAQAWQGVLKPATANLNSQWQTAIVDNWDRAFAGRYPFAGGDS
EISLPMLGQFIRSDSGRIEQFLTRQLGGILHKAGNQWVVDEVNGQGVQINPDFLKAINQL
SQLSDLLFADGSQGLRFELRARAVRDVVETDLTIDGQKLRYFNQMESWQSFRWPGETYKP
GVMLTWTSVNAGARLFGDYQGNWGLIRWLAQAKAERLDESRYRLIFTAPDGLPLTWILRT
ELGEGPLALLKLRGFKLPKNIFVVMPGNHTTISAVNDDDLIEE
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaatcgtcaccaccaatatggctattttgggtatatttttattacccttagc
cttgccgggatatttctcatgttgatctacttgaatcaaacattacttgaggaacggggg
ctgcttaaatccgtatggtatgcctacgctaccgtttttccgatcctattaataggctta
tttggcaatgctgtctggtggcatattcggcagaataaagcgcagaaaaaactcagacct
gaaaccgagcggacagcggatcgctccagccagtctgctttggtactgagtgacttgggc
gatcgcatgcgcctccgttacgggcggttctggtggtataaagtccgcattttactggtg
gtgggcgaagtggagcaggtggaagccatcgcgccggggctgaccacgacgcactggcag
gagggttatcgcacgctgttgctctggggcggcagtttgcaagcggaaccgaataccgct
caattgatggccctgcgtcgcttgcgccgttaccgcccgctcaatgccattgtctgggcg
ctgaccgaaaaccaaagtgcgcagccggtatggatggacaaggccctgaggatgttgcaa
aaacaggcccaacagttacgctggcaggctccggtctacctgtggcaggtgtgtcacagt
acctggtctcaggaaggtcgtatcactcagaccgtcggctgtttttttcctgaacgctgt
accccggatatcgtggcgacacagttacaaacgttggttgacccgttgcgcgagcgcggg
atgcagcaactgttggagaagacggcccacgattttctctgtcgtctgtccgcgaacttg
aaacaacaggggattgcgcactggcaacaggtcctgacgccgtggttagcggagtatggt
gatgtggtgtcgctgcggggtttgatgttcagtttgccgcttaaagcgcagacgactcgc
ctcccgcagatctggctgcccgacacggcatggcagggggtgttggagggcagtcgttgt
ttccacggtcggcgggtgggcatgctccacacacagaccgtttgtcgtggcctgatagtg
ctgggcttgttatggggggccggaatgatgctctcctttttcaccaaccgtgaccagcta
gccgtggtgcaggcggcggtaactgacctgaaagtccagccggagaattctgatgcccag
ttgatggccttgaaggatctgcgtaacgaggtggaccggctgcaagaccgggctgaacac
ggcgtgccgtggtatgagcgctttggtttgagtcagaatcagaaactgttgacggcggtg
ctgcccgattatgcgcaggttaataaccgcctgatacgggacaaagccgctgcggtgttg
catgcgaaactgagtgcgctggtgaatttaccgccgggcagccctttgcgggctaagcgg
gcgcaagccggtcatgaccagttgaaagcctacctgatgatggcgcggccggaaaaagtg
gatgctgtgtttttaacccggatactggatgaaaatgaacccgagcgggccggtattgcc
cccggtgtctggctggatacggcgtgggatttgtggagtttttatgcggagaatctggcc
gcgcatcccgaatggcggataaccgcggataaggcgttgattaaacaggtgcgtcagttg
ttgctgctccagccaggtaagcacaatgccgaagcggcgctttaccagcagatgctgcaa
tcagtggagaaaaattattcggacctgacgttaaggcagatgaccggcgacaccgatgcg
gcgcggctgtttaccacctctcacgtgataccggggatgtttacccgtcaggcgtgggaa
ggcgggatacaaaaggcgatagcgaaggcggtggcgtcacgtaaagaggcaattgactgg
gtgctgagtgataaccgtcaggcagtctcggcgtcggtatcgcccgaagagctgaaagcc
cgtttgaccgcccgttactttaccgatttcgccagggtgtggcaggattttctcaacagc
ctgcgctggaacaaaacccgtaacctgtcggatgtcatcgaccagctaacgttgatggcg
gatggacggcagtctccgctgattgcgctgatgaacacgctggcctatcagggcgaaacc
gggcaacaggggccgagtttatcggactcattggtgaaatccgctaaaacgttattgaat
aaaaaaacgccgcgaatgattaatcaacagacggctggcttgcacgggccgatggatgaa
acctttgggccgttgctggcgctgatgggagaaaatcaggcagaaggaagaatcaaggcg
gacagtaccctgaatttacaaaccttcttgacccgggtaaccgacgtgcgtctgaaactg
caacagatgaacaacagcgacgacccaccggcaatggcgaatgcgctggctaagacggta
tttgaagggaaaagtactgatttgaccgatactcagggttatgggcgcttgatagccgcc
agtctgggcggccaatggcggagttttggtcagacgctgtttgtcgagccattagcgcag
gcgtggcagggagtattgaaaccggcgacggcgaatctgaatagccagtggcagacggcg
atagtggacaactgggatcgggcatttgcgggtcgttatccgtttgccggtggcgacagt
gaaatttcattgccgatgttggggcaatttatccggtcagattcggggcggatagagcag
ttcttgacgcgtcagttaggcgggatactgcataaagcgggtaaccagtgggtagtggat
gaggtgaatggtcagggcgtgcagattaacccggattttctaaaggcgataaatcagctc
agtcagttatcggacctgttgtttgcggatggcagtcagggattgcggtttgaactgcgg
gccagagcggtgcgggatgtggtggaaactgacctgacgatagatgggcagaaactgcgt
tattttaaccagatggaaagctggcagagctttcgctggccgggagagacctataaaccg
ggtgtgatgctgacgtggaccagtgtcaatgccggggcgagattgtttggtgattatcag
gggaactgggggctgatccgctggctggcacaggcgaaagcggagaggctggatgaaagc
cgttaccgactgatatttaccgcgccggatggattaccgttaacctggattttgcgcaca
gaattgggcgaagggccgctggcgttattaaaactgcgcggatttaaattgccgaaaaat
atctttgtagtgatgccgggtaatcacacgacaatatcagcggtaaatgacgatgatttg
atagaggaatag

DBGET integrated database retrieval system