KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu3262
Entry
plu3262           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to unknown protein
  KO
K11901  type VI secretion system protein ImpB
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu3262
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu3262
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAE15636
Pasteur: plu3262
UniProt: Q7N240
Position
complement(3863474..3863971)
AA seq 165 aa
MTHSFQNEIPKSRINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEHLPLGERKKVAINK
NNFDSVLAEFSPAINLTVKNTLAGDGSEENIALIFRQIKDFEPEQIARQIPQLRALLSMR
HLLRDLRSNLLDNTTFRRELEHILQDQALSDELRAELAALAPKTI
NT seq 498 nt   +upstreamnt  +downstreamnt
atgacccatagttttcaaaacgagatccctaaatcgcgtattaatatcaagttagattta
catacaggaggtgcgcagaaaaaagttgagctgccgctgaaattattggtcatgggggat
tatagcaacgggcaggaacatctccctcttggggaaagaaaaaaagtggctatcaataaa
aacaattttgatagcgtactggctgaattcagtcccgcgattaacttgacggtcaaaaat
accttggccggagatggcagcgaggagaatatcgcccttatttttcggcaaataaaagac
ttcgagcctgaacaaattgctcgtcaaatcccgcaactgcgggccctgctttctatgcgc
catctattgcgcgatctgagatctaacctgctcgataacaccacctttcgccgggaactg
gaacatatcctccaggatcaagcgttaagcgatgagttacgggctgaactggccgcactg
gcaccaaaaacgatttga

DBGET integrated database retrieval system