KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu3622Help
Entry
plu3622           CDS       T00149                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00010  Glycolysis / Gluconeogenesis
plu00020  Citrate cycle (TCA cycle)
plu00620  Pyruvate metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01130  Biosynthesis of antibiotics
plu01200  Carbon metabolism
Module
plu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu3622 (aceF)
   00020 Citrate cycle (TCA cycle)
    plu3622 (aceF)
   00620 Pyruvate metabolism
    plu3622 (aceF)
Enzymes [BR:plu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     plu3622 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAE15995
Pasteur: plu3622
UniProt: Q7N173
Position
complement(4271312..4272910)
Genome map
AA seq 532 aa AA seqDB search
MAIKIKVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIIIA
VGDKVETDKLIMIFDSAEGAVEAAPAEAPAAVTLSSRMAEPEPVASAAMKVHVPDIGGDE
VEVTEVMVKVGDAVEAEQSLITVEGDKASMEVPAPFAGIVKEIQIKAGDKVETGSMIMVF
EVAGAAPVAPVASAPAPTAEPEKAAVPVIASRSFAEEDKNDFAENSAYVHATPVIRRLAR
EFGVNLAKVKGTGRKGRVLREDVQAYVKDAVKRAESAPASAGGGLPGMLPWPKVDFSKFG
EIEEVELGRIQKISGANLSRNWVVIPHVTQFDETDITEVENFRKQQNQEAEKKQLGVKIT
PLVFIIKAVAKALEEMPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKG
IIELSRELTEMSKKARAGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSRS
SMKPVWNGKEFVPRLMLPLSLSFDHRVIDGADGARFITFINHAMSDIRRLVM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaaattaaggtaccggatatcggtgcggacgaagttgaagtcaccgaaatc
atggtgaaagttggcgatacagtggaagctgagcaatcgctgatcaccgtggaaggtgat
aaggcttcgatggaagttccatccccacaggcgggtgttgttaaagagatcatcattgcg
gttggcgataaagttgaaaccgacaaactgattatgatttttgattccgcggaaggtgct
gtagaagctgcgccagcggaagcgccagcagcggtaacattgtcttcgcgtatggcagag
ccagaacccgtagcttctgcggctatgaaggttcatgtaccggatatcggcggtgatgag
gtcgaagttaccgaagtgatggtgaaagttggcgatgcagtggaagctgaacaatcgttg
atcaccgtagagggcgataaagcctctatggaagtccccgcgccattcgccggtatcgtt
aaagaaattcaaatcaaagccggtgataaagtggaaaccggttctatgatcatggtattc
gaagtcgcgggtgcagcacctgttgctccggttgcctctgcgccagctccaactgctgaa
ccagagaaagcagcagtaccggttattgctagcagaagcttcgcagaagaagacaaaaat
gatttcgctgaaaatagcgcttatgttcatgcaacgccggtgatccgtcgcctggcgcgt
gaattcggcgttaacctggctaaagtgaaaggtacagggcgtaaaggccgtgttctgcgt
gaagatgttcaggcttacgtgaaagacgcggttaaacgtgcagaatcggctcctgcatca
gccggtggtggtctgccgggtatgttgccttggccgaaagtggatttcagcaaatttggt
gaaattgaagaagttgagctgggtcgtattcagaaaatctctggtgctaacctgagccgt
aactgggtggtgatcccacatgttacacagttcgacgaaacggatatcactgaagttgaa
aacttccgtaaacagcagaatcaggaagctgagaagaaacagcttggcgtgaagattact
ccgctagtattcatcataaaagcggtagcaaaagcgctggaagagatgccgcgctttaac
agctctatctcggaagatggtcagaaactgacgctgaaaaaatacatcaacattggtgtg
gcagttgatacacctaatggtctggtggttccagtgttccgtgatgttaataagaagggc
atcattgaattgtcccgcgagctgactgagatgtctaagaaagcgcgtgcaggcaaactg
accgcatctgatatgcaggggggatgcttcactatttcaagtctggggggtatcggtggc
acagcattcacgccaatcgttaatgcaccagaagtggctatcctgggcgtatcccgctca
tcaatgaagccagtatggaatggtaaagagtttgttccacgcctgatgctacctctgtca
ctctctttcgatcaccgtgtgatcgatggtgctgatggtgcgcgtttcatcacatttatt
aatcatgcgatgagcgatatccgccgtctggtgatgtaa

DBGET integrated database retrieval system