KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4211
Entry
plu4211           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to Hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    plu4211
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plu02044]
    plu4211
Secretion system [BR:plu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   plu4211
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAE16583
Pasteur: plu4211
UniProt: Q7MZR6
Position
complement(4925955..4926446)
AA seq 163 aa
MAIPAYLWLKDDGGADIKGSVDVHNREGSIEVVALEHALHIPTDNNTGKLTGTRVHAPLV
FTKEVDASSPYLYKAVTTGQTLKSAEFKWYQIDDAGQEKVYFITHLNNVKVVKVAPLMHD
IKDPTKEKHNHLERVELRYEKITWTYKDGNIIHSDAWNERSQA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaatccctgcgtatttatggttgaaagatgacggcggtgccgacattaaaggttcg
gtggatgtacacaaccgggaaggcagtattgaggtggtggcgctggaacatgcgctacat
atcccgacggataacaataccggcaagctgaccggcacccgtgtgcatgcgccgctggtg
tttactaaagaggtcgatgcgtctagcccgtatctgtataaagcggtgacaacgggtcag
accctgaaatcggcggaattcaaatggtaccaaattgatgatgctggtcaggagaaggtc
tatttcatcactcatctgaacaacgtgaaggtggtgaaagtggcaccgttgatgcatgac
atcaaagatccgactaaagagaagcacaaccatctggaacgtgtcgaacttcgttacgaa
aaaatcacttggacgtacaaagacggcaacatcattcactctgatgcgtggaatgagcgc
agtcaggcgtaa

DBGET integrated database retrieval system