KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4407Help
Entry
plu4407           CDS       T00149                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase (porphobilinogen synthase) (ALAD) (ALADH)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00860  Porphyrin and chlorophyll metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
Module
plu_M00121  Heme biosynthesis, glutamate => heme
plu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    plu4407 (hemB)
Enzymes [BR:plu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     plu4407 (hemB)
Exosome [BR:plu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   plu4407 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAE16779
Pasteur: plu4407
UniProt: Q7MZ87
Position
complement(5156176..5157189)
Genome map
AA seq 337 aa AA seqDB search
MSYAFPGTFPGRRMRRLRCHDFSRRLVAENQLTVNDLIYPVFVMEGINRRQEVPSMPGVY
RLTMDLLLKEAEEIARLGIPVLSLFPVIEADKKSLDAEEAYNPDGLVQRTVRALKDAIPE
LGLLTDVALDPFTTHGQDGIIDQDGYVMNDITKEILVKQALSHAEAGAEIVAPSDMMDGR
IGAIRELFETEGHVNTQIMAYSAKYASGYYGPFRDAIGSNRNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADTVMVKPGMPYLDVIRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEQVIVESLLCFKRAGADGVLTYFAKQVAQQLYEQKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccaggaactttccctggtcgacgtatgcgccggttgcgctgccat
gatttttcccgccgtctggttgctgaaaaccaattaactgttaatgatttaatctatcct
gtatttgtgatggagggcattaatcgtcgtcaagaagtgccctctatgccaggagtgtat
cgtctgacgatggatctgttgctgaaagaagctgaagagattgcccggctggggattcct
gtattgtctctgttccccgttattgaagcagataaaaaatctctggatgcggaagaagct
tataaccctgatgggttggttcagcgtacggttcgtgcgttgaaagatgccattcctgag
ctaggattgctgactgatgtggcattagatccattcactacacatggtcaggatgggatc
atcgatcaagatggttatgtgatgaatgatataaccaaagagatcttggtcaaacaggca
ttgtcacatgcagaagctggtgctgagattgtggcaccgagcgacatgatggatgggcgt
attggtgcaatccgtgaactatttgaaacggaaggacatgtaaatactcaaattatggct
tactccgctaagtatgcttctgggtattacggcccattccgtgatgcaatcggttcaaat
cgtaatctgaaagggggcaataaaaaaacctatcagatggaccctgcgaatagtgatgaa
gcattgcaggagattgcacaggatttgcaggaaggcgctgacactgtaatggtaaaacca
ggtatgccctacctggatgttattcgcagggtaaaagatacatttggtgtaccaaccttt
gcttatcaagtctctggcgaatatgccatgcacatggctgctattcagaatggttggtta
caggaacaggtaattgtggagtctctgttatgcttcaagcgtgcaggagccgatggtgta
ctgacctattttgcgaaacaggttgctcaacagttatatgaacagaaacgttaa

DBGET integrated database retrieval system