KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4418Help
Entry
plu4418           CDS       T00149                                 

Definition
(GenBank) unnamed protein product; Highly similar to pyrrolidone-carboxylate peptidase (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase)
  KO
K01304  pyroglutamyl-peptidase [EC:3.4.19.3]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Brite
KEGG Orthology (KO) [BR:plu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:plu01002]
    plu4418
Enzymes [BR:plu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.3  pyroglutamyl-peptidase I
     plu4418
Peptidases [BR:plu01002]
 Cysteine Peptidases
  Family C15: pyroglutamyl peptidase I family
   plu4418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C15 NiFe_hyd_3_EhaA DUF555
Motif
Other DBs
NCBI-ProteinID: CAE16790
Pasteur: plu4418
UniProt: Q7MZ76
Position
5166814..5167470
Genome map
AA seq 218 aa AA seqDB search
MTTQKTVLITGFEPFGKETINPSWEAAKQLQGRELCGARVEARQLPCVFDVSLACLYAAI
DDVQPDLVIAVGQAGGRPNITVERVAININDASIPDNQGNQPINTPIVATGPAAYFATLP
INAIVKGLRDAGVPASISQTAGTFVCNHVMYGLLHHLACIYPEIRGGVLHIPYLPEQAAR
YSGTPSMALETVITALEIAIDEALKNSEDIANNGDTAH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaaaaaacagttttaattacaggtttcgaacctttcggtaaagaaacgatt
aatccatcctgggaagctgctaagcaattacaggggcgagaattatgcggagcccgcgtt
gaagcgcgtcagcttccatgtgtgttcgacgtctctctggcttgtctgtatgctgctatt
gatgatgtacaacctgatctggtcattgccgtgggacaggcaggcggcagaccaaatatt
actgtggaacgcgtggcaattaatatcaatgatgctagcatccctgataatcaaggtaat
cagcctatcaatacccccatcgtcgcaacaggccctgccgcctacttcgccacgttaccg
atcaatgcgatagtcaagggtttgcgtgatgcaggagtgccagcctccatttcacaaacc
gcaggcactttcgtctgtaaccacgtcatgtatggcctgttgcatcatttggcatgcatc
tatcctgaaatacgcggtggagttctccatatcccttatctgcctgagcaagcagctcgg
tattcaggaacgccaagtatggccctagaaacagttataacagcgctggaaattgctatc
gatgaagcattaaaaaacagtgaagatatcgccaataatggagacacagctcattaa

DBGET integrated database retrieval system