KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4492Help
Entry
plu4492           CDS       T00149                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic chain (aspartate transcarbamylase) (ATCase)
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00240  Pyrimidine metabolism
plu00250  Alanine, aspartate and glutamate metabolism
plu01100  Metabolic pathways
Module
plu_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    plu4492 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    plu4492 (pyrB)
Enzymes [BR:plu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     plu4492 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAE16864
Pasteur: plu4492
UniProt: Q7MZ16
Position
5247435..5248358
Genome map
AA seq 307 aa AA seqDB search
MANPLYRKHIISINDLSREDLELVLQTAATLKARPQPELLKPKVIASCFFEASTRTRLSF
ETAIHRLGASVVGFSDSSNTSLGKKGETLADTISVISQYVDAIVIRHPQEGAPRLASEFS
GDTPIINAGDGANQHPTQTLLDLFTIQETQQRLDSLNIAMVGDLKYGRTVHSLSQALAKF
NGNHFYFIAPEALAMPNHILHMLNEKGATYSQHANIEEVLPELDILYMTRVQKERLDPSE
YANVKAQFVLRASDLIGAKENLKVLHPLPRIDEITADVDKTPYAYYFQQAENGIYARQAL
LSLVLNE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgttatatcgcaaacatatcatctcaataaatgatctgagccgcgaagat
ctggaattggtgttgcagactgctgctacactgaaagccagaccacaacctgaattgctg
aaacccaaggttatcgccagttgtttcttcgaagcctccacccgtactcgcctctctttt
gaaacagcaatccaccgccttggcgcttcagttgtcggtttctcagacagcagtaacacc
tctctgggtaagaaaggtgaaacgctagccgatactatttccgttatcagccaatatgtt
gacgccatcgtgatacgtcatccacaggaaggtgctccacgtctggcttctgaattttcc
ggtgacactccgattatcaatgccggtgatggtgctaaccaacatccgactcaaaccttg
ctggatctattcactattcaggaaactcagcaacggctggatagtctgaatatcgcgatg
gttggtgatctgaaatatggccgcacggtccattcgctatcacaagcactggcgaaattt
aatggcaatcacttttattttatcgccccggaagcattggcaatgccaaaccatattctt
catatgctgaatgaaaaaggtgcgacctacagccaacacgctaatattgaagaagtatta
ccggagctagatattctttatatgacccgcgtacagaaagagcgccttgatccatccgaa
tatgccaacgtaaaagcacaatttgttctgcgtgcttccgatctgatcggagcgaaagag
aacctcaaagttctgcatccattgccacgtattgatgaaatcactgccgatgtcgataaa
acgccctatgcttattatttccaacaggcagagaatggtatttatgctcgtcaggctcta
ctatctttagttttaaatgaatga

DBGET integrated database retrieval system