KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4772Help
Entry
plu4772           CDS       T00149                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00010  Glycolysis / Gluconeogenesis
plu00051  Fructose and mannose metabolism
plu00562  Inositol phosphate metabolism
plu01100  Metabolic pathways
plu01110  Biosynthesis of secondary metabolites
plu01120  Microbial metabolism in diverse environments
plu01130  Biosynthesis of antibiotics
plu01200  Carbon metabolism
plu01230  Biosynthesis of amino acids
Module
plu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
plu_M00002  Glycolysis, core module involving three-carbon compounds
plu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    plu4772 (tpiA)
   00051 Fructose and mannose metabolism
    plu4772 (tpiA)
   00562 Inositol phosphate metabolism
    plu4772 (tpiA)
Enzymes [BR:plu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     plu4772 (tpiA)
Exosome [BR:plu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   plu4772 (tpiA)
  Exosomal proteins of bladder cancer cells
   plu4772 (tpiA)
  Exosomal proteins of melanoma cells
   plu4772 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE17144
Pasteur: plu4772
UniProt: Q7MYB3
Position
5553567..5554334
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELITGLRQELSSVTGCDVAIAPPALYLSQAKQALAGSRIA
LGAQDVDVNLSGAFTGETSATMLKDIGAEYIIIGHSERRTYHQESDEFIAKKFAILKQQG
LIPVLCIGETEQENEAGQTESVCARQIDAVLNTLGVAAFQGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAQKDAAIAQQIIIQYGGSVNADNAAELFSQPDIDGALVGGASLKAN
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaaattgaatggcagcacccatatggttaac
gaactcatcactggcctgcgtcaagaattaagcagtgttaccggctgtgacgtcgctatc
gcgccaccagcgctttatctctctcaggctaaacaagcactggctggcagccgcattgct
ctaggtgcacaggacgttgacgttaacctgtctggtgcatttaccggtgaaacttccgcc
acaatgttgaaagacattggcgcagaatacattattatcggccactctgaacgccgtact
taccaccaagaaagtgacgaattcattgcgaaaaaatttgccattcttaaacaacaaggt
ctaatccctgttttgtgcatcggcgaaactgaacaggaaaatgaagccggccaaactgaa
agtgtatgtgcaaggcaaattgatgcagttctgaacacattgggagtagcagccttccaa
ggtgcggtcatcgcttacgaacctgtttgggcaattggtacaggcaaatcagcaacaccg
gcacaagctcaagctgtgcataaattcatccgtgatcatattgcgcagaaagatgcagca
atcgcacaacaaatcattatccagtacggtggctctgtgaacgcagataatgccgctgag
ctattctctcagccagacattgacggtgcattagtcggcggtgcatctctaaaagctaac
gctttcgctgttatcgtaaaagccgcagccgctgcgaaaaaagcctaa

DBGET integrated database retrieval system