KEGG   Photorhabdus laumondii subsp. laumondii TTO1: plu4798Help
Entry
plu4798           CDS       T00149                                 

Gene name
wblC
Definition
(GenBank) WblC protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
plu  Photorhabdus laumondii subsp. laumondii TTO1
Pathway
plu00520  Amino sugar and nucleotide sugar metabolism
plu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    plu4798 (wblC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:plu01005]
    plu4798 (wblC)
Enzymes [BR:plu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     plu4798 (wblC)
Lipopolysaccharide biosynthesis proteins [BR:plu01005]
 Unusual sugar
  plu4798 (wblC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954 BacteriocIIc_cy AFP_2
Motif
Other DBs
NCBI-ProteinID: CAE17170
Pasteur: plu4798
UniProt: Q7MY90
Position
5572133..5572720
Genome map
AA seq 195 aa AA seqDB search
MSAEHIMIHPSAIVDEGAQIGKNSRIWHFTHVCSGAQIGEGCSLGQNVFIGNQVTIGNHC
KIQNNVSVYDNVHLEDGVFCGPSMVFTNVYNPRSLIERKSEYQNTWVKKGATLGANCTIV
CGTTIGAYAFIGAGAVVNKDVPDYALMVGVPAKHIGWMSEFGEQLDLPLHGQATATCPHT
QHIYQLNNHIVVRIK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagaacacataatgatacatcccagtgccatcgttgatgaaggggctcaaatc
ggcaaaaacagccgtatctggcatttcacccacgtctgctcaggtgctcaaattggcgaa
ggctgttctctgggccaaaatgtctttattggcaatcaagtcactatcggcaatcactgc
aaaatacaaaataatgtttctgtttatgacaatgttcatctggaagatggggtattttgt
ggcccaagcatggtgttcaccaatgtttataatccgcgttcattgattgaaagaaaaagt
gaatatcaaaacacctgggtaaaaaaaggcgccaccttaggtgccaactgtaccattgtt
tgtggcaccaccattggcgcttatgcttttattggtgccggcgcggtggtgaataaagat
gttcctgattatgccctgatggtgggtgtgccggctaaacacattggctggatgagtgaa
tttggtgaacaattagatttaccgctacacggacaagccaccgccacctgtcctcacact
cagcatatttatcaactcaataaccatattgtcgtgcgaattaaataa

DBGET integrated database retrieval system