KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_01180Help
Entry
A4R40_01180       CDS       T05478                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00010  Glycolysis / Gluconeogenesis
plum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4R40_01180
Enzymes [BR:plum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A4R40_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AWK40233
Position
257136..257762
Genome map
AA seq 208 aa AA seqDB search
MLYIFDMGNVIIEIDFKRVLAVWSNLSGTPLATLTKSFSMGETFEKHERGQITDLEFADT
LCQEMNISLSFEQFAAGWHAIFINIRPEVIQIMKTLREAGHRVVVLSNTNRLHLDYWPHN
YPEIAASADYLYLSQDLAMRKPEPDIFKYVLETEGYSPDQAVFFDDVLENVEAAKALGIN
SVHVVDRQTVPDYFEAIGFSEQNEGLNG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgttatatatcttcgatatgggtaatgtgatcattgagattgattttaaaagagtttta
gcggtatggagtaatttgagcgggacacctcttgcgactttgactaaaagtttctctatg
ggagaaacgtttgaaaaacatgagcgtggtcaaattactgatctggaattcgctgatact
ttatgtcaggaaatgaatatttcactcagttttgagcagtttgctgctggatggcatgct
atctttattaatattcggcctgaagtcattcagataatgaaaacattgcgtgaggcggga
caccgggttgtcgtgttatccaacaccaaccgtttgcacctcgattactggccacataat
tatcctgagattgcggcatccgctgattacctctatttgtcgcaggatttggcaatgcgt
aaacctgaacctgatattttcaaatatgtgcttgagacagagggttattcaccggatcag
gccgtgttttttgacgatgtgctggaaaatgtggaagcagccaaggcgttagggatcaat
agcgttcatgttgttgataggcagacagtgccagattatttcgaagcaatcggtttttct
gaacaaaatgagggattgaacggataa

DBGET integrated database retrieval system